http://2014hs.igem.org/wiki/index.php?title=Special:Contributions/Rozakd&feed=atom&limit=50&target=Rozakd&year=&month=2014hs.igem.org - User contributions [en]2024-03-19T05:02:57ZFrom 2014hs.igem.orgMediaWiki 1.16.5http://2014hs.igem.org/Team:FHS_Frederick_MD/MembersTeam:FHS Frederick MD/Members2014-06-21T03:19:55Z<p>Rozakd: /* Members and Attributions */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Members and Attributions=<br />
{| cellpadding="20"<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:KyleA.jpg|100px]]<br />
|style="vertical-align:top;"|'''Kyle Andrushko''' is an Eagle scout on the road to becoming an optometrist. Having recently graduated from Frederick High school, Kyle is planning on attending UMBC for his undergraduate degree with a major in biology and a minor in business. John's Hopkins medical school will be his next step after taking the OAT. Kyle will be participating in the iGEMs competition in Boston this summer. He has just finished up his first year of iGEMs and has gained expertise in the concepts of the NirB promoter gene. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DillonK.jpg|100px]]<br />
|style="vertical-align:top;"|'''Dillon Kestner''' is a Frederick High School graduate who has been inspired by the iGEMs club as well as his mentors Mark Trice and Dave Rozak to pursue a career in neuroscience. He plans to attend a local community college in order to continue being involved in his high school's iGEMs club and mentor future participants before transferring to Muhlenberg College to acquire a doctorate in neuroscience. Dillon specialized in the 3A assembly process for his group. Dillon looks ahead to the trip to Boston and seeing his group's work pay off as well as all the work put in by groups from all over the world.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:JonathonS.jpg|100px]]<br />
|style="vertical-align:top;"|'''Jonathon Soward''' is an 18 year-old who loves the study of life. Jonathon attributes his love of STEM to a string of inspiring STEM teachers at his school, including Mark Trice, Shelley Miller, and Joyce Tuten. His teachers, as well as his diligence and work ethic, has enabled him to decide upon pursuing a degree in both dentistry and microbiology. Jonathon has been a member of the iGEM team at Frederick High School for the past two years. He has also become resident expert in the light, oxygen, and voltage sensor protein(LOV). Jonathon's nickname is "master pipettor" because of his amazing pipetting skills!<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:AlanN.jpg|100px]]<br />
|style="vertical-align:top;"|'''Alan Nguyen''' is a recent graduate of Frederick High School and incoming Freshman to Mount St. Mary's University. Alan has taken an interest in biology and its many forms. This interest has given him the drive to pursue a career in medicine, a choice that he wouldn't have made without his AP Biology teacher, Mr. Trice's inspiration. A two year veteran of the iGEM group, Alan is excited to see the fruits of his group's labor as it unfolds at the iGEMS competition held at MIT. He's specialized himself in microbial fuel cells and now has a fuller understanding of his group's experiments. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:MarkT.jpg|100px]]<br />
|style="vertical-align:top;"|'''Mark Trice''' is a teacher at Frederick High School, where he teachers classes such as Chemistry, Physics, Biology, and Advanced Placement Biology. He also serves as the vice president on the board for the nonprofit organization, Ars Biotechnica. Mark has worked with his iGEM club for two years and is so excited to see this project come to fruition.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DaveR.jpg|100px]]<br />
|style="vertical-align:top;"|'''David Rozak''' is a research scientist at the United States Army Medical Research Institute for Infectious Diseases and a founding director of the nonprofit organization, Ars Biotechnica, Inc. Dave has been working with the Frederick High School Bioengineering Club for two years and served as an advisor to our iGEM team.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:GaryL.jpg|100px]]<br />
|style="vertical-align:top;"|'''Gary Lopez''' is an original founding member of the Frederick High Bioengineering Club. He graduated from Fredrick High School (with more accolades than are imaginable) and has transitioned to becoming a Hood College student. He has also taken the huge leap from curios member to knowledgeable mentor. His future goals include working in the biotechnology field, achieving a double major in biochemistry and computer science, and eventually owning your own biotechnology company.<br />
|}<br />
<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/TransformationsTeam:FHS Frederick MD/Transformations2014-06-21T03:16:31Z<p>Rozakd: /* Transformations */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Transformations=<br />
<br />
[[File:Transformants.jpg|right|300px]]<br />
<br />
It may be hard to see in this photo, but there were 10-50 colonies on the chloramphenicol agar plates we inoculated with pSB1C3/NirB and pSB1C3/LOV transformed ''E. coli''! We also ran a negative control and saw no sign of growth. <br />
<br />
After weeks of trying to transform commercially-produced LyoComp bacteria and homemade chemically competent ''E. coli'', the latter approach finally achieved a high enough transformation efficiency for us to propagate and test multiple clones containing our synthetic [[Team:FHS_Frederick_MD/NirB_Promoter|NirB]] and [[Team:FHS_Frederick_MD/LOV_Domain|LOV]] genes. In subsequent experiments, we subcultured five colonies from each plate, extracted the plasmid DNA, and analyzed it using [[Team:FHS_Frederick_MD/Electrophoresis|gel electrophoresis]] and [[Team:FHS_Frederick_MD/Sequencing|DNA sequencing]].<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/HeaderTeam:FHS Frederick MD/Header2014-06-21T03:13:36Z<p>Rozakd: </p>
<hr />
<div>__NOTOC__<br />
[[File:FHS_Logo.png|center|500px]]<br />
<br />
<html lang="en"> <br />
<br />
<head><br />
<style type="text/css"><br />
<br />
/*<br />
This header was adapted from the header developed by Team:Sharon_MA_Aquila in 2012<br />
*/<br />
<br />
#globalwrapper <br />
{<br />
width:975px;<br />
padding:20px 0px;<br />
margin: 0 auto;<br />
background-color:#ffffff;<br />
height:100%;<br />
}<br />
<br />
.firstHeading <br />
{<br />
height:0px;<br />
visibility:hidden;<br />
}<br />
<br />
body <br />
{<br />
/* background-image: url('http://img85.imageshack.us/img85/8767/tileskynew.jpg'); */<br />
background-position: center;<br />
}<br />
<br />
#p-logo <br />
{<br />
height:1px; overflow:hidden; display: none;<br />
}<br />
<br />
#top-section <br />
{<br />
background: #ffffff;<br />
/* background-image: url('http://img4.imageshack.us/img4/549/igemheader.jpg'); */<br />
background-position: top;<br />
height:20px ;<br />
background-repeat: no-repeat;<br />
border-width:0px;<br />
border-top-width:1px;<br />
<br />
}<br />
<br />
#content <br />
{<br />
border-left-width:0px;<br />
border-right-width:0px;<br />
padding:5px;<br />
width:965px;<br />
}<br />
<br />
#menubar <br />
{ <br />
background-color: white; <br />
}<br />
<br />
#menubar ul li a <br />
{ <br />
color: #999999; }<br />
.right-menu li a {<br />
color: black;<br />
background-color: white;<br />
}<br />
<br />
</style><br />
</head><br />
<br />
<body><br />
<html><br />
<head><br />
<meta><br />
<style><br />
<br />
#navbar <br />
{<br />
margin: 1600;<br />
padding: 0;<br />
height: 1em; <br />
position: relative;<br />
//left: 80px;<br />
}<br />
#navbar a:hover <br />
{<br />
background-color:#033EAB; <!navbar hover color><br />
text-decoration:underline;<br />
}<br />
#navbar li <br />
{<br />
list-style: none;<br />
float: left; <br />
}<br />
#navbar li a <br />
{<br />
padding-left: 10px;<br />
padding-bottom: 2px;<br />
padding-right: 10px;<br />
padding-top: 2px;<br />
display: block;<br />
// background-color: #002261;<br />
background-color: black;<br />
color: yellow;<br />
text-decoration: none; <br />
border-right:2px solid yellow;<br />
}<br />
#navbar li ul <br />
{<br />
display: none; <br />
width: 12em;<br />
background-color: #000000;<br />
}<br />
#navbar li:hover ul, #navbar li.hover ul <br />
{<br />
display: block;<br />
position: absolute;<br />
background-color: #ffffff;<br />
margin: 0;<br />
padding: 0; <br />
}<br />
#navbar li:hover li, #navbar li.hover li <br />
{<br />
float: none; <br />
}<br />
#navbar li:hover li a, #navbar li.hover li a <br />
{<br />
// background-color: #002261; /*Dropdown color*/<br />
background-color: black;<br />
color: white; <br />
}<br />
#navbar li li a:hover <br />
{<br />
background-color: #033EAB; <br />
}<br />
</style><br />
<br />
<script><br />
// Javascript originally by Patrick Griffiths and Dan Webb.<br />
// http://htmldog.com/articles/suckerfish/dropdowns/<br />
<br />
sfHover = function() <br />
{<br />
var sfEls = document.getElementById("navbar").getElementsByTagName("li");<br />
for (var i=0; i<sfEls.length; i++) <br />
{<br />
sfEls[i].onmouseover=function() <br />
{<br />
this.className+=" hover";<br />
}<br />
sfEls[i].onmouseout=function() <br />
{<br />
this.className=this.className.replace(new RegExp(" hover\\b"), "");<br />
}<br />
}<br />
}<br />
<br />
if (window.attachEvent) window.attachEvent("onload", sfHover);<br />
<br />
</script><br />
<br />
</head><br />
<br />
</a><br />
<br />
<body><br />
<div id="wrap"><br />
<center><br />
<table><br />
<tr><br />
<td><br />
<ul id="navbar"><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Description">TEAM</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Description">Description</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Members">Members and Attributions</a></li><br />
<li><a href="https://igem.org/Team.cgi?year=2014&division=high_school&team_name=FHS_Frederick_MD">Official Profile</a></li><br />
</ul><br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">PROJECT</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">Overview</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Microbial_Fuel_Cells">Microbial Fuel Cells</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/NirB_Promoter">NirB Promoter</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/LOV_Domain">LOV Domain</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">RESEARCH</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">Materials and Methods</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Notebook">Lab Notebook</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Safety">Safety</a></li> <br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">RESULTS</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">Transformations</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Electrophoresis">Electrophoresis</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sequencing">Sequencing</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Outlook">Outlook</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/HumanPractices">HUMAN PRACTICES</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Renewable_Energy">Renewable Energy</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Clean_Water">Clean Water</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Basic_Research">Basic Research</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Public_Awareness">Public Awareness</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sponsors">SPONSORS</a> </li><br />
</ul><br />
</td><br />
</tr><br />
</table> </center><br />
</div><br />
<br />
</body><br />
<br />
<br />
<!--navigation menu--><br />
<ul class="navbar"><br />
<br />
<br />
</ul><br />
<br />
</body><br />
</html><br />
<br />
<br />
<html lang="en"> <br />
<head><br />
<style type="text/css"><br />
<br />
#col_left<br />
{<br />
float: left;<br />
width: 576px;<br />
padding: 30px 0px;<br />
margin:0;<br />
}<br />
<br />
#col_right<br />
{<br />
float: right;<br />
width: 242px;<br />
padding: 30px 28px 30px 15px;<br />
margin:0;<br />
}<br />
<br />
#col_center<br />
{<br />
float: center;<br />
width: 576;<br />
padding: 0px 100px;<br />
margin:0;<br />
}<br />
#col_nav<br />
{<br />
float: left;<br />
width: 200px;<br />
padding: 30px 15px 30px 50px;<br />
margin:0;<br />
}<br />
<br />
#block-content<br />
{<br />
padding-bottom: 15px;<br />
clear:both;<br />
}<br />
<br />
</style><br />
</head><br />
</html><br />
<div id="col_center"><br />
<div id="block-content"><br />
</div><!--end block-content--></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/MembersTeam:FHS Frederick MD/Members2014-06-21T03:12:44Z<p>Rozakd: /* Attributions */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Members and Attributions=<br />
{| cellpadding="20"<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:KyleA.jpg|100px]]<br />
|style="vertical-align:top;"|'''Kyle Andrushko''' is an Eagle scout on the road to becoming an optometrist. Having recently graduated from Frederick High school, Kyle is planning on attending UMBC for his undergraduate degree with a major in biology and a minor in business. John's Hopkins medical school will be his next step after taking the OAT. Kyle will be participating in the iGEMs competition in Boston this summer. He has just finished up his first year of iGEMs and has gained expertise in the concepts of the NirB promoter gene. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DillonK.jpg|100px]]<br />
|style="vertical-align:top;"|'''Dillon Kestner''' is a Frederick High School graduate who has been inspired by the iGEMs club as well as his mentors Mark Trice and Dave Rozak to pursue a career in neuroscience. He plans to attend a local community college in order to continue being involved in his high school's iGEMs club and mentor future participants before transferring to Muhlenberg College to acquire a doctorate in neuroscience. Dillon specialized in the 3A assembly process for his group. Dillon looks ahead to the trip to Boston and seeing his group's work pay off as well as all the work put in by groups from all over the world.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:JonathonS.jpg|100px]]<br />
|style="vertical-align:top;"|'''Jonathon Soward''' is an 18 year-old who loves the study of life. Jonathon attributes his love of STEM to a string of inspiring STEM teachers at his school, including Mark Trice, Shelley Miller, and Joyce Tuten. His teachers, as well as his diligence and work ethic, has enabled him to decide upon pursuing a degree in both dentistry and microbiology. Jonathon has been a member of the iGEM team at Frederick High School for the past two years. He has also become resident expert in the light, oxygen, and voltage sensor protein(LOV). Jonathon's nickname is "master pipettor" because of his amazing pipetting skills!<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:AlanN.jpg|100px]]<br />
|style="vertical-align:top;"|'''Alan Nguyen''' is a recent graduate of Frederick High School and incoming Freshman to Mount St. Mary's University. Alan has taken an interest in biology and its many forms. This interest has given him the drive to pursue a career in medicine, a choice that he wouldn't have made without his AP Biology teacher, Mr. Trice's inspiration. A two year veteran of the iGEM group, Alan is excited to see the fruits of his group's labor as it unfolds at the iGEMS competition held at MIT. He's specialized himself in microbial fuel cells and now has a fuller understanding of his group's experiments. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:MarkT.jpg|100px]]<br />
|style="vertical-align:top;"|'''Mark Trice''' is a teacher at Frederick High School, where he teachers classes such as Chemistry, Physics, Biology, and Advanced Placement Biology. He also serves as the vice president on the board for the nonprofit organization, Ars Biotechnica. Mark has worked with his iGEM club for two years and is so excited to see this project come to fruition.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DaveR.jpg|100px]]<br />
|style="vertical-align:top;"|'''David Rozak''' is a research scientist at the United States Army Medical Research Institute for Infectious Diseases and a founding director of the nonprofit organization, Ars Biotechnica, Inc. Dave has been working with the Frederick High School Bioengineering Club for two years and served as an advisor to our iGEM team.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:GaryL.jpg|100px]]<br />
|style="vertical-align:top;"|'''Gary Lopez'''is an original founding member of the Frederick High Bioengineering Club. He graduated from Fredrick High School (with more accolades than are imaginable) and has transitioned to becoming a Hood College student. He has also taken the huge leap from curios member to knowledgeable mentor. His future goals include working in the biotechnology field, achieving a double major in biochemistry and computer science, and eventually owning your own biotechnology company.<br />
|}<br />
<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/HeaderTeam:FHS Frederick MD/Header2014-06-21T03:12:12Z<p>Rozakd: </p>
<hr />
<div>__NOTOC__<br />
[[File:FHS_Logo.png|center|500px]]<br />
<br />
<html lang="en"> <br />
<br />
<head><br />
<style type="text/css"><br />
<br />
/*<br />
This header was adapted from the header developed by Team:Sharon_MA_Aquila in 2012<br />
*/<br />
<br />
#globalwrapper <br />
{<br />
width:975px;<br />
padding:20px 0px;<br />
margin: 0 auto;<br />
background-color:#ffffff;<br />
height:100%;<br />
}<br />
<br />
.firstHeading <br />
{<br />
height:0px;<br />
visibility:hidden;<br />
}<br />
<br />
body <br />
{<br />
/* background-image: url('http://img85.imageshack.us/img85/8767/tileskynew.jpg'); */<br />
background-position: center;<br />
}<br />
<br />
#p-logo <br />
{<br />
height:1px; overflow:hidden; display: none;<br />
}<br />
<br />
#top-section <br />
{<br />
background: #ffffff;<br />
/* background-image: url('http://img4.imageshack.us/img4/549/igemheader.jpg'); */<br />
background-position: top;<br />
height:20px ;<br />
background-repeat: no-repeat;<br />
border-width:0px;<br />
border-top-width:1px;<br />
<br />
}<br />
<br />
#content <br />
{<br />
border-left-width:0px;<br />
border-right-width:0px;<br />
padding:5px;<br />
width:965px;<br />
}<br />
<br />
#menubar <br />
{ <br />
background-color: white; <br />
}<br />
<br />
#menubar ul li a <br />
{ <br />
color: #999999; }<br />
.right-menu li a {<br />
color: black;<br />
background-color: white;<br />
}<br />
<br />
</style><br />
</head><br />
<br />
<body><br />
<html><br />
<head><br />
<meta><br />
<style><br />
<br />
#navbar <br />
{<br />
margin: 1600;<br />
padding: 0;<br />
height: 1em; <br />
position: relative;<br />
//left: 80px;<br />
}<br />
#navbar a:hover <br />
{<br />
background-color:#033EAB; <!navbar hover color><br />
text-decoration:underline;<br />
}<br />
#navbar li <br />
{<br />
list-style: none;<br />
float: left; <br />
}<br />
#navbar li a <br />
{<br />
padding-left: 10px;<br />
padding-bottom: 2px;<br />
padding-right: 10px;<br />
padding-top: 2px;<br />
display: block;<br />
// background-color: #002261;<br />
background-color: black;<br />
color: yellow;<br />
text-decoration: none; <br />
border-right:2px solid yellow;<br />
}<br />
#navbar li ul <br />
{<br />
display: none; <br />
width: 12em;<br />
background-color: #000000;<br />
}<br />
#navbar li:hover ul, #navbar li.hover ul <br />
{<br />
display: block;<br />
position: absolute;<br />
background-color: #ffffff;<br />
margin: 0;<br />
padding: 0; <br />
}<br />
#navbar li:hover li, #navbar li.hover li <br />
{<br />
float: none; <br />
}<br />
#navbar li:hover li a, #navbar li.hover li a <br />
{<br />
// background-color: #002261; /*Dropdown color*/<br />
background-color: black;<br />
color: white; <br />
}<br />
#navbar li li a:hover <br />
{<br />
background-color: #033EAB; <br />
}<br />
</style><br />
<br />
<script><br />
// Javascript originally by Patrick Griffiths and Dan Webb.<br />
// http://htmldog.com/articles/suckerfish/dropdowns/<br />
<br />
sfHover = function() <br />
{<br />
var sfEls = document.getElementById("navbar").getElementsByTagName("li");<br />
for (var i=0; i<sfEls.length; i++) <br />
{<br />
sfEls[i].onmouseover=function() <br />
{<br />
this.className+=" hover";<br />
}<br />
sfEls[i].onmouseout=function() <br />
{<br />
this.className=this.className.replace(new RegExp(" hover\\b"), "");<br />
}<br />
}<br />
}<br />
<br />
if (window.attachEvent) window.attachEvent("onload", sfHover);<br />
<br />
</script><br />
<br />
</head><br />
<br />
</a><br />
<br />
<body><br />
<div id="wrap"><br />
<center><br />
<table><br />
<tr><br />
<td><br />
<ul id="navbar"><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Description">TEAM</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Description">Description</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Members">Attributions</a></li><br />
<li><a href="https://igem.org/Team.cgi?year=2014&division=high_school&team_name=FHS_Frederick_MD">Official Profile</a></li><br />
</ul><br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">PROJECT</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">Overview</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Microbial_Fuel_Cells">Microbial Fuel Cells</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/NirB_Promoter">NirB Promoter</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/LOV_Domain">LOV Domain</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">RESEARCH</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">Materials and Methods</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Notebook">Lab Notebook</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Safety">Safety</a></li> <br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">RESULTS</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">Transformations</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Electrophoresis">Electrophoresis</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sequencing">Sequencing</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Outlook">Outlook</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/HumanPractices">HUMAN PRACTICES</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Renewable_Energy">Renewable Energy</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Clean_Water">Clean Water</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Basic_Research">Basic Research</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Public_Awareness">Public Awareness</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sponsors">SPONSORS</a> </li><br />
</ul><br />
</td><br />
</tr><br />
</table> </center><br />
</div><br />
<br />
</body><br />
<br />
<br />
<!--navigation menu--><br />
<ul class="navbar"><br />
<br />
<br />
</ul><br />
<br />
</body><br />
</html><br />
<br />
<br />
<html lang="en"> <br />
<head><br />
<style type="text/css"><br />
<br />
#col_left<br />
{<br />
float: left;<br />
width: 576px;<br />
padding: 30px 0px;<br />
margin:0;<br />
}<br />
<br />
#col_right<br />
{<br />
float: right;<br />
width: 242px;<br />
padding: 30px 28px 30px 15px;<br />
margin:0;<br />
}<br />
<br />
#col_center<br />
{<br />
float: center;<br />
width: 576;<br />
padding: 0px 100px;<br />
margin:0;<br />
}<br />
#col_nav<br />
{<br />
float: left;<br />
width: 200px;<br />
padding: 30px 15px 30px 50px;<br />
margin:0;<br />
}<br />
<br />
#block-content<br />
{<br />
padding-bottom: 15px;<br />
clear:both;<br />
}<br />
<br />
</style><br />
</head><br />
</html><br />
<div id="col_center"><br />
<div id="block-content"><br />
</div><!--end block-content--></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/MembersTeam:FHS Frederick MD/Members2014-06-21T03:11:13Z<p>Rozakd: /* Attribution */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Attributions=<br />
{| cellpadding="20"<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:KyleA.jpg|100px]]<br />
|style="vertical-align:top;"|'''Kyle Andrushko''' is an Eagle scout on the road to becoming an optometrist. Having recently graduated from Frederick High school, Kyle is planning on attending UMBC for his undergraduate degree with a major in biology and a minor in business. John's Hopkins medical school will be his next step after taking the OAT. Kyle will be participating in the iGEMs competition in Boston this summer. He has just finished up his first year of iGEMs and has gained expertise in the concepts of the NirB promoter gene. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DillonK.jpg|100px]]<br />
|style="vertical-align:top;"|'''Dillon Kestner''' is a Frederick High School graduate who has been inspired by the iGEMs club as well as his mentors Mark Trice and Dave Rozak to pursue a career in neuroscience. He plans to attend a local community college in order to continue being involved in his high school's iGEMs club and mentor future participants before transferring to Muhlenberg College to acquire a doctorate in neuroscience. Dillon specialized in the 3A assembly process for his group. Dillon looks ahead to the trip to Boston and seeing his group's work pay off as well as all the work put in by groups from all over the world.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:JonathonS.jpg|100px]]<br />
|style="vertical-align:top;"|'''Jonathon Soward''' is an 18 year-old who loves the study of life. Jonathon attributes his love of STEM to a string of inspiring STEM teachers at his school, including Mark Trice, Shelley Miller, and Joyce Tuten. His teachers, as well as his diligence and work ethic, has enabled him to decide upon pursuing a degree in both dentistry and microbiology. Jonathon has been a member of the iGEM team at Frederick High School for the past two years. He has also become resident expert in the light, oxygen, and voltage sensor protein(LOV). Jonathon's nickname is "master pipettor" because of his amazing pipetting skills!<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:AlanN.jpg|100px]]<br />
|style="vertical-align:top;"|'''Alan Nguyen''' is a recent graduate of Frederick High School and incoming Freshman to Mount St. Mary's University. Alan has taken an interest in biology and its many forms. This interest has given him the drive to pursue a career in medicine, a choice that he wouldn't have made without his AP Biology teacher, Mr. Trice's inspiration. A two year veteran of the iGEM group, Alan is excited to see the fruits of his group's labor as it unfolds at the iGEMS competition held at MIT. He's specialized himself in microbial fuel cells and now has a fuller understanding of his group's experiments. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:MarkT.jpg|100px]]<br />
|style="vertical-align:top;"|'''Mark Trice''' is a teacher at Frederick High School, where he teachers classes such as Chemistry, Physics, Biology, and Advanced Placement Biology. He also serves as the vice president on the board for the nonprofit organization, Ars Biotechnica. Mark has worked with his iGEM club for two years and is so excited to see this project come to fruition.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DaveR.jpg|100px]]<br />
|style="vertical-align:top;"|'''David Rozak''' is a research scientist at the United States Army Medical Research Institute for Infectious Diseases and a founding director of the nonprofit organization, Ars Biotechnica, Inc. Dave has been working with the Frederick High School Bioengineering Club for two years and served as an advisor to our iGEM team.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:GaryL.jpg|100px]]<br />
|style="vertical-align:top;"|'''Gary Lopez'''is an original founding member of the Frederick High Bioengineering Club. He graduated from Fredrick High School (with more accolades than are imaginable) and has transitioned to becoming a Hood College student. He has also taken the huge leap from curios member to knowledgeable mentor. His future goals include working in the biotechnology field, achieving a double major in biochemistry and computer science, and eventually owning your own biotechnology company.<br />
|}<br />
<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/MembersTeam:FHS Frederick MD/Members2014-06-21T03:10:30Z<p>Rozakd: /* Members */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Attribution=<br />
{| cellpadding="20"<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:KyleA.jpg|100px]]<br />
|style="vertical-align:top;"|'''Kyle Andrushko''' is an Eagle scout on the road to becoming an optometrist. Having recently graduated from Frederick High school, Kyle is planning on attending UMBC for his undergraduate degree with a major in biology and a minor in business. John's Hopkins medical school will be his next step after taking the OAT. Kyle will be participating in the iGEMs competition in Boston this summer. He has just finished up his first year of iGEMs and has gained expertise in the concepts of the NirB promoter gene. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DillonK.jpg|100px]]<br />
|style="vertical-align:top;"|'''Dillon Kestner''' is a Frederick High School graduate who has been inspired by the iGEMs club as well as his mentors Mark Trice and Dave Rozak to pursue a career in neuroscience. He plans to attend a local community college in order to continue being involved in his high school's iGEMs club and mentor future participants before transferring to Muhlenberg College to acquire a doctorate in neuroscience. Dillon specialized in the 3A assembly process for his group. Dillon looks ahead to the trip to Boston and seeing his group's work pay off as well as all the work put in by groups from all over the world.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:JonathonS.jpg|100px]]<br />
|style="vertical-align:top;"|'''Jonathon Soward''' is an 18 year-old who loves the study of life. Jonathon attributes his love of STEM to a string of inspiring STEM teachers at his school, including Mark Trice, Shelley Miller, and Joyce Tuten. His teachers, as well as his diligence and work ethic, has enabled him to decide upon pursuing a degree in both dentistry and microbiology. Jonathon has been a member of the iGEM team at Frederick High School for the past two years. He has also become resident expert in the light, oxygen, and voltage sensor protein(LOV). Jonathon's nickname is "master pipettor" because of his amazing pipetting skills!<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:AlanN.jpg|100px]]<br />
|style="vertical-align:top;"|'''Alan Nguyen''' is a recent graduate of Frederick High School and incoming Freshman to Mount St. Mary's University. Alan has taken an interest in biology and its many forms. This interest has given him the drive to pursue a career in medicine, a choice that he wouldn't have made without his AP Biology teacher, Mr. Trice's inspiration. A two year veteran of the iGEM group, Alan is excited to see the fruits of his group's labor as it unfolds at the iGEMS competition held at MIT. He's specialized himself in microbial fuel cells and now has a fuller understanding of his group's experiments. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:MarkT.jpg|100px]]<br />
|style="vertical-align:top;"|'''Mark Trice''' is a teacher at Frederick High School, where he teachers classes such as Chemistry, Physics, Biology, and Advanced Placement Biology. He also serves as the vice president on the board for the nonprofit organization, Ars Biotechnica. Mark has worked with his iGEM club for two years and is so excited to see this project come to fruition.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DaveR.jpg|100px]]<br />
|style="vertical-align:top;"|'''David Rozak''' is a research scientist at the United States Army Medical Research Institute for Infectious Diseases and a founding director of the nonprofit organization, Ars Biotechnica, Inc. Dave has been working with the Frederick High School Bioengineering Club for two years and served as an advisor to our iGEM team.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:GaryL.jpg|100px]]<br />
|style="vertical-align:top;"|'''Gary Lopez'''is an original founding member of the Frederick High Bioengineering Club. He graduated from Fredrick High School (with more accolades than are imaginable) and has transitioned to becoming a Hood College student. He has also taken the huge leap from curios member to knowledgeable mentor. His future goals include working in the biotechnology field, achieving a double major in biochemistry and computer science, and eventually owning your own biotechnology company.<br />
|}<br />
<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/File:IGEM_Unboxing.jpgFile:IGEM Unboxing.jpg2014-06-21T03:06:48Z<p>Rozakd: uploaded a new version of &quot;File:IGEM Unboxing.jpg&quot;</p>
<hr />
<div></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Renewable_EnergyTeam:FHS Frederick MD/Renewable Energy2014-06-21T03:03:52Z<p>Rozakd: /* Renewable Energy */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Renewable Energy=<br />
[[File:FHS_Talk.jpg|right|400px]]<br />
The renewable energy being produced by the fuel cell is the electricity. With the growing epidemic of energy scarcity, this production of a clean renewable source of energy with readily available use of nutrients is a unique answer to an age-old problem. The microbial fuel cell produces electricity by converting cellular energy released during metabolic reactions into electrical energy. This is due to bacteria growing on a negative electrode, as long as there is waste for the bacteria to consume electricity will continue to produce. An alternative fuel that is produce by microbial fuel cells is hydrogen in an anaerobic environment. The waste eating bacteria can also be in lakes to clean from organic pollutants benzene and toluene.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Renewable_EnergyTeam:FHS Frederick MD/Renewable Energy2014-06-21T03:03:30Z<p>Rozakd: /* Renewable Energy */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Renewable Energy=<br />
[[File:Selfie.jpg|right|400px]]<br />
The renewable energy being produced by the fuel cell is the electricity. With the growing epidemic of energy scarcity, this production of a clean renewable source of energy with readily available use of nutrients is a unique answer to an age-old problem. The microbial fuel cell produces electricity by converting cellular energy released during metabolic reactions into electrical energy. This is due to bacteria growing on a negative electrode, as long as there is waste for the bacteria to consume electricity will continue to produce. An alternative fuel that is produce by microbial fuel cells is hydrogen in an anaerobic environment. The waste eating bacteria can also be in lakes to clean from organic pollutants benzene and toluene.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_MethodsTeam:FHS Frederick MD/Materials and Methods2014-06-21T03:03:04Z<p>Rozakd: /* Materials and Methods */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Materials and Methods=<br />
Following the direction of work completed by [http://www.nature.com/nbt/journal/v25/n4/abs/nbt1293.html Drepper et al. 2007], the LOV fluorescent gene was modified for use in this experiment by altering one amino acid in the protein increasing the illumination given by the bacteria compared to the wild type gene. The increased fluorescence of the bacterial colonies makes the bacterial growth within the fuel cell easier to monitor. <br />
<br />
The NirB gene has already been synthesized by other iGEM teams ([http://parts.igem.org/Part:BBa_K763002 BBa_K763002]) and was reproduced here only by adding a prefix and suffix nucleotide strain in order to use it in the 3A Assembly process. The LOV gene also received this same prefix and suffix sequence. Please see our [[Team:FHS_Frederick_MD/Project|project section]] for details on how the [[Team:FHS_Frederick_MD/LOV_Domain|LOV]] and [[Team:FHS_Frederick_MD/NirB_Promoter|NirB]] genes were designed.<br />
<br />
Each engineered gene was synthesized as an IDT gBlock fragment and incorporated into the pSB1C3 construction plasmid by cutting each with restriction enzymes followed by ligation. <br />
<br />
After different plasmids containing one of the genes were made they were propagated in separate ''E. coli'' bacterial colonies. Each strain was cultivated in a liquid broth and centrifuged to concentrate a bacterial pellet. <br />
<br />
The DNA was then extracted from the bacteria and purified using QIAprep purification kit. Before continuing we had to confirm the incorporation of the plasmid into the bacterial DNA so a sample was run through gel electrophoresis. <br />
<br />
Finally, the plasmids were submitted for sequencing. The plasmid containing the LOV gene was successful with the proper DNA sequence present. However, the plasmid with the NirB gene failed to form properly so we were unable to complete the 3A assembly process to then combine those plasmids. This will become a future project for our group in order to continue fashioning a more effective microbial fuel cell.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/File:FHS_Talk.jpgFile:FHS Talk.jpg2014-06-21T03:02:26Z<p>Rozakd: </p>
<hr />
<div></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_MethodsTeam:FHS Frederick MD/Materials and Methods2014-06-21T03:02:03Z<p>Rozakd: /* Materials and Methods */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Materials and Methods=<br />
[[File:FHS_Talk.jpg|right|400px]]<br />
Following the direction of work completed by [http://www.nature.com/nbt/journal/v25/n4/abs/nbt1293.html Drepper et al. 2007], the LOV fluorescent gene was modified for use in this experiment by altering one amino acid in the protein increasing the illumination given by the bacteria compared to the wild type gene. The increased fluorescence of the bacterial colonies makes the bacterial growth within the fuel cell easier to monitor. <br />
<br />
The NirB gene has already been synthesized by other iGEM teams ([http://parts.igem.org/Part:BBa_K763002 BBa_K763002]) and was reproduced here only by adding a prefix and suffix nucleotide strain in order to use it in the 3A Assembly process. The LOV gene also received this same prefix and suffix sequence. Please see our [[Team:FHS_Frederick_MD/Project|project section]] for details on how the [[Team:FHS_Frederick_MD/LOV_Domain|LOV]] and [[Team:FHS_Frederick_MD/NirB_Promoter|NirB]] genes were designed.<br />
<br />
Each engineered gene was synthesized as an IDT gBlock fragment and incorporated into the pSB1C3 construction plasmid by cutting each with restriction enzymes followed by ligation. <br />
<br />
After different plasmids containing one of the genes were made they were propagated in separate ''E. coli'' bacterial colonies. Each strain was cultivated in a liquid broth and centrifuged to concentrate a bacterial pellet. <br />
<br />
The DNA was then extracted from the bacteria and purified using QIAprep purification kit. Before continuing we had to confirm the incorporation of the plasmid into the bacterial DNA so a sample was run through gel electrophoresis. <br />
<br />
Finally, the plasmids were submitted for sequencing. The plasmid containing the LOV gene was successful with the proper DNA sequence present. However, the plasmid with the NirB gene failed to form properly so we were unable to complete the 3A assembly process to then combine those plasmids. This will become a future project for our group in order to continue fashioning a more effective microbial fuel cell.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/File:Presentation.jpgFile:Presentation.jpg2014-06-21T02:59:06Z<p>Rozakd: </p>
<hr />
<div></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/HumanPracticesTeam:FHS Frederick MD/HumanPractices2014-06-21T02:58:37Z<p>Rozakd: /* Human Practices */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Human Practices=<br />
[[File:Presentation.jpg|right|400px]]As renewable energy and alternative energy resources have become more and more important in the world we live in today, answers, not suggestions, must be found. The research we enacted will allow naturally-occurring bacteria in the soil to generate electricity, rather than traditional methods, such as coal. Through the genetic engineering of the bacteria, we will be able to enhance the bacteria's ability to deposit electrons on the electrodes to produce electricity.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/File:FHS_Notes.jpgFile:FHS Notes.jpg2014-06-21T02:46:13Z<p>Rozakd: </p>
<hr />
<div></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/NotebookTeam:FHS Frederick MD/Notebook2014-06-21T02:45:48Z<p>Rozakd: /* Lab Notebook */ Notebook photo</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Lab Notebook=<br />
[[File:FHS_Notes.jpg|right|300px]]<br />
* [http://arsbiotechnica.org/w/Article:002-001 20 Feb 2014]: Received iGEM supplies<br />
* [http://arsbiotechnica.org/w/Record:002-010 03 Apr 2014]: Digested NirB and LOV inserts<br />
* [http://arsbiotechnica.org/w/Record:002-011 10 Apr 2014]: Ligated NirB and LOV genes into pSB1C3<br />
* [http://arsbiotechnica.org/w/Record:002-012 14 Apr 2014]: Transformed ''E. coli'' with LOV and NirB constructs<br />
* [http://arsbiotechnica.org/w/Record:002-013 21 Apr 2014]: Ligated NirB and LOV genes into pSB1C3<br />
* [http://arsbiotechnica.org/w/Record:002-014 28 Apr 2014]: Transformed ''E. coli'' with LOV and NirB constructs<br />
* [http://arsbiotechnica.org/w/Record:002-015 01 May 2014]: Prepared TSS buffer<br />
* [http://arsbiotechnica.org/w/Record:002-016 05 May 2014]: Ligatied the RFP plasmid<br />
* [http://arsbiotechnica.org/w/Record:002-017 08 May 2014]: Subcultured ''E. coli'' NEB10 Beta<br />
* [http://arsbiotechnica.org/w/Record:002-018 08 May 2014]: Tested transformation efficiency of competent cells<br />
* [http://arsbiotechnica.org/w/Record:002-020 12 May 2014]: Digested NirB, LOV, pSB1C3 DNA fragments with EcoRI and PstI<br />
* [http://arsbiotechnica.org/w/Record:002-021 15 May 2014]: Ligated NirB and LOV into pSB1C3<br />
* [http://arsbiotechnica.org/w/Record:002-022 20 May 2014]: Transformed ''E. coli'' with LOV and NirB constructs <br />
* [http://arsbiotechnica.org/w/Record:002-023 29 May 2014]: Cultured individual NirB and LOV colonies<br />
* [http://arsbiotechnica.org/w/Record:002-024 02 Jun 2014]: Purified NirB and LOV plasmids<br />
* [http://arsbiotechnica.org/w/Record:002-025 03 Jun 2014]: Visualized NirB and LOV plasmids on a gel<br />
* [http://arsbiotechnica.org/w/Record:002-026 04 Jun 2014]: Recultured NirB and LOV transformants<br />
* [http://arsbiotechnica.org/w/Record:002-027 05 Jun 2014]: Extracted plasmid DNA from bacterial transformants<br />
* [http://arsbiotechnica.org/w/Record:002-028 06 Jun 2014]: Observed plasmid DNA on a gel<br />
* [http://arsbiotechnica.org/w/Record:002-029 09 Jun 2014]: Submitted samples for sequencing<br />
* [http://arsbiotechnica.org/w/Record:002-030 11 Jun 2014]: Resubmitted DNA for sequencing<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Public_AwarenessTeam:FHS Frederick MD/Public Awareness2014-06-21T02:40:32Z<p>Rozakd: /* Public Awareness */</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Public Awareness=<br />
[[File:Selfie.jpg|right|400px]]This year the Frederick High Bioengineering Club is not only on the fast track to Boston but also to recognition. Purely through word of mouth Maryland Senator Ben Cardin came to Frederick High to visit with the group. <br />
<br />
The team presented their research on biofuel cells from the previous years, explained in detail why they won their division at last year's Frederick County science fair, and described what they were currently working on. <br />
<br />
Thanks to Senator Cardin's interest in our budding iGEM team, we received some local news coverage. Given this opportunity, the team members took the time to also highlight the importance of STEM, expressing how STEM programs such as AP Biology, Chemistry, Environmental Science, and Calculus were great opportunities for students to get their feet wet and explore STEM. <br />
<br />
This media coverage provoked the local Career and Technology center at Frederick Community College to consider making their own iGEM teams with the aid of the non profit organization created by team mentors Mark Trice, Dave Rozak, and Gary Lopez. <br />
<br />
The [http://www.fredericknewspost.com/news/education/education_topics/learning/genetic-research-sparks-science-careers-at-frederick-high/article_a221dc2d-6208-58b9-b45f-7aed61b37ce3.html Frederick News Posts] covered Senator Cardin's time with the iGEMs group. <br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/File:Selfie.jpgFile:Selfie.jpg2014-06-21T02:40:01Z<p>Rozakd: </p>
<hr />
<div></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Public_AwarenessTeam:FHS Frederick MD/Public Awareness2014-06-21T02:32:49Z<p>Rozakd: /* Public Awareness */ Trying different photo</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Public Awareness=<br />
[[File:Selfie.jpg|right|300px]]This year the Frederick High Bioengineering Club is not only on the fast track to Boston but also to recognition. Purely through word of mouth Maryland Senator Ben Cardin came to Frederick High to visit with the group. <br />
<br />
The team presented their research on biofuel cells from the previous years, explained in detail why they won their division at last year's Frederick County science fair, and described what they were currently working on. <br />
<br />
Thanks to Senator Cardin's interest in our budding iGEM team, we received some local news coverage. Given this opportunity, the team members took the time to also highlight the importance of STEM, expressing how STEM programs such as AP Biology, Chemistry, Environmental Science, and Calculus were great opportunities for students to get their feet wet and explore STEM. <br />
<br />
This media coverage provoked the local Career and Technology center at Frederick Community College to consider making their own iGEM teams with the aid of the non profit organization created by team mentors Mark Trice, Dave Rozak, and Gary Lopez. <br />
<br />
The [http://www.fredericknewspost.com/news/education/education_topics/learning/genetic-research-sparks-science-careers-at-frederick-high/article_a221dc2d-6208-58b9-b45f-7aed61b37ce3.html Frederick News Posts] covered Senator Cardin's time with the iGEMs group. <br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/File:IGEM_Unboxing.jpgFile:IGEM Unboxing.jpg2014-06-21T02:24:05Z<p>Rozakd: </p>
<hr />
<div></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/DescriptionTeam:FHS Frederick MD/Description2014-06-21T02:23:27Z<p>Rozakd: /* Description */ Changed photo</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Description=<br />
[[File:iGEM_Unboxing.jpg|right|500px]]<br />
The Frederick High School Bioengineering team was formed in October 2012 to give students in the Frederick MD public school an opportunity to learn about molecular and synthetic biology by by working on after-school bioengineering projects. <br />
<br />
In the club's first year, members decided to explore the development and use of microbial fuel cells as a potential source of renewable energy. We began by building a simple fuel cell using the commercially available MudWatt kit and soil collected from a local pond. <br />
<br />
The MudWatt experiment lead us to consider the possibilities of building a more refined two-chamber microbial fuel cell in which we would use fluorescent bacteria to visually monitor the growth of bacteria on the cathode.<br />
<br />
Although we were not able to participate in last year's iGEM competition we're looking forward to attending the June 2014 Jamboree.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/DescriptionTeam:FHS Frederick MD/Description2014-06-21T02:07:09Z<p>Rozakd: /* Description */ Formatting</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Description=<br />
[[File:Tshirts.jpg|right|500px]]<br />
The Frederick High School Bioengineering team was formed in October 2012 to give students in the Frederick MD public school an opportunity to learn about molecular and synthetic biology by by working on after-school bioengineering projects. <br />
<br />
In the club's first year, members decided to explore the development and use of microbial fuel cells as a potential source of renewable energy. We began by building a simple fuel cell using the commercially available MudWatt kit and soil collected from a local pond. <br />
<br />
The MudWatt experiment lead us to consider the possibilities of building a more refined two-chamber microbial fuel cell in which we would use fluorescent bacteria to visually monitor the growth of bacteria on the cathode.<br />
<br />
Although we were not able to participate in last year's iGEM competition we're looking forward to attending the June 2014 Jamboree.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/DescriptionTeam:FHS Frederick MD/Description2014-06-21T02:03:47Z<p>Rozakd: Initial draft</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Description=<br />
[[File:Tshirts.jpg|right|500px]]<br />
The Frederick High School Bioengineering team was formed in October 2012 to give students in the Frederick MD public school an opportunity to learn about molecular and synthetic biology by by working on after-school bioengineering projects. In it's first year, club members decided to explore the development and use of microbial fuel cells as a potential source of renewable energy. We began by building a simple fuel cell using the commercially available MudWatt kit and soil collected from a local pond. This initial experiment lead us to consider the possibilities of building a more refined two-chamber microbial fuel cell in which we would use fluorescent bacteria to visually monitor the growth of bacteria on the cathode.<br />
<br />
Although we were not able to participate in last year's iGEM competition we're looking forward to attending the June 2014 Jamboree.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/HeaderTeam:FHS Frederick MD/Header2014-06-21T01:47:00Z<p>Rozakd: Added a team description to the menu</p>
<hr />
<div>__NOTOC__<br />
[[File:FHS_Logo.png|center|500px]]<br />
<br />
<html lang="en"> <br />
<br />
<head><br />
<style type="text/css"><br />
<br />
/*<br />
This header was adapted from the header developed by Team:Sharon_MA_Aquila in 2012<br />
*/<br />
<br />
#globalwrapper <br />
{<br />
width:975px;<br />
padding:20px 0px;<br />
margin: 0 auto;<br />
background-color:#ffffff;<br />
height:100%;<br />
}<br />
<br />
.firstHeading <br />
{<br />
height:0px;<br />
visibility:hidden;<br />
}<br />
<br />
body <br />
{<br />
/* background-image: url('http://img85.imageshack.us/img85/8767/tileskynew.jpg'); */<br />
background-position: center;<br />
}<br />
<br />
#p-logo <br />
{<br />
height:1px; overflow:hidden; display: none;<br />
}<br />
<br />
#top-section <br />
{<br />
background: #ffffff;<br />
/* background-image: url('http://img4.imageshack.us/img4/549/igemheader.jpg'); */<br />
background-position: top;<br />
height:20px ;<br />
background-repeat: no-repeat;<br />
border-width:0px;<br />
border-top-width:1px;<br />
<br />
}<br />
<br />
#content <br />
{<br />
border-left-width:0px;<br />
border-right-width:0px;<br />
padding:5px;<br />
width:965px;<br />
}<br />
<br />
#menubar <br />
{ <br />
background-color: white; <br />
}<br />
<br />
#menubar ul li a <br />
{ <br />
color: #999999; }<br />
.right-menu li a {<br />
color: black;<br />
background-color: white;<br />
}<br />
<br />
</style><br />
</head><br />
<br />
<body><br />
<html><br />
<head><br />
<meta><br />
<style><br />
<br />
#navbar <br />
{<br />
margin: 1600;<br />
padding: 0;<br />
height: 1em; <br />
position: relative;<br />
//left: 80px;<br />
}<br />
#navbar a:hover <br />
{<br />
background-color:#033EAB; <!navbar hover color><br />
text-decoration:underline;<br />
}<br />
#navbar li <br />
{<br />
list-style: none;<br />
float: left; <br />
}<br />
#navbar li a <br />
{<br />
padding-left: 10px;<br />
padding-bottom: 2px;<br />
padding-right: 10px;<br />
padding-top: 2px;<br />
display: block;<br />
// background-color: #002261;<br />
background-color: black;<br />
color: yellow;<br />
text-decoration: none; <br />
border-right:2px solid yellow;<br />
}<br />
#navbar li ul <br />
{<br />
display: none; <br />
width: 12em;<br />
background-color: #000000;<br />
}<br />
#navbar li:hover ul, #navbar li.hover ul <br />
{<br />
display: block;<br />
position: absolute;<br />
background-color: #ffffff;<br />
margin: 0;<br />
padding: 0; <br />
}<br />
#navbar li:hover li, #navbar li.hover li <br />
{<br />
float: none; <br />
}<br />
#navbar li:hover li a, #navbar li.hover li a <br />
{<br />
// background-color: #002261; /*Dropdown color*/<br />
background-color: black;<br />
color: white; <br />
}<br />
#navbar li li a:hover <br />
{<br />
background-color: #033EAB; <br />
}<br />
</style><br />
<br />
<script><br />
// Javascript originally by Patrick Griffiths and Dan Webb.<br />
// http://htmldog.com/articles/suckerfish/dropdowns/<br />
<br />
sfHover = function() <br />
{<br />
var sfEls = document.getElementById("navbar").getElementsByTagName("li");<br />
for (var i=0; i<sfEls.length; i++) <br />
{<br />
sfEls[i].onmouseover=function() <br />
{<br />
this.className+=" hover";<br />
}<br />
sfEls[i].onmouseout=function() <br />
{<br />
this.className=this.className.replace(new RegExp(" hover\\b"), "");<br />
}<br />
}<br />
}<br />
<br />
if (window.attachEvent) window.attachEvent("onload", sfHover);<br />
<br />
</script><br />
<br />
</head><br />
<br />
</a><br />
<br />
<body><br />
<div id="wrap"><br />
<center><br />
<table><br />
<tr><br />
<td><br />
<ul id="navbar"><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Description">TEAM</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Description">Description</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Members">Members</a></li><br />
<li><a href="https://igem.org/Team.cgi?year=2014&division=high_school&team_name=FHS_Frederick_MD">Official Profile</a></li><br />
</ul><br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">PROJECT</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">Overview</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Microbial_Fuel_Cells">Microbial Fuel Cells</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/NirB_Promoter">NirB Promoter</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/LOV_Domain">LOV Domain</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">RESEARCH</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">Materials and Methods</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Notebook">Lab Notebook</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Safety">Safety</a></li> <br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">RESULTS</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">Transformations</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Electrophoresis">Electrophoresis</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sequencing">Sequencing</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Outlook">Outlook</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/HumanPractices">HUMAN PRACTICES</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Renewable_Energy">Renewable Energy</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Clean_Water">Clean Water</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Basic_Research">Basic Research</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Public_Awareness">Public Awareness</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sponsors">SPONSORS</a> </li><br />
</ul><br />
</td><br />
</tr><br />
</table> </center><br />
</div><br />
<br />
</body><br />
<br />
<br />
<!--navigation menu--><br />
<ul class="navbar"><br />
<br />
<br />
</ul><br />
<br />
</body><br />
</html><br />
<br />
<br />
<html lang="en"> <br />
<head><br />
<style type="text/css"><br />
<br />
#col_left<br />
{<br />
float: left;<br />
width: 576px;<br />
padding: 30px 0px;<br />
margin:0;<br />
}<br />
<br />
#col_right<br />
{<br />
float: right;<br />
width: 242px;<br />
padding: 30px 28px 30px 15px;<br />
margin:0;<br />
}<br />
<br />
#col_center<br />
{<br />
float: center;<br />
width: 576;<br />
padding: 0px 100px;<br />
margin:0;<br />
}<br />
#col_nav<br />
{<br />
float: left;<br />
width: 200px;<br />
padding: 30px 15px 30px 50px;<br />
margin:0;<br />
}<br />
<br />
#block-content<br />
{<br />
padding-bottom: 15px;<br />
clear:both;<br />
}<br />
<br />
</style><br />
</head><br />
</html><br />
<div id="col_center"><br />
<div id="block-content"><br />
</div><!--end block-content--></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MDTeam:FHS Frederick MD2014-06-21T01:43:27Z<p>Rozakd: </p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Overview=<br />
[[File:Tshirts.jpg|right|500px]]<br />
We are interested in creating a [[Team:FHS_Frederick_MD/Microbial_Fuel_Cells|microbial fuel cell]] that utilizes the facultative anaerobic bacteria, ''Shewanella oneidensis'', to produce [[Team:FHS_Frederick_MD/Renewable_Energy|renewable energy]] and [[Team:FHS_Frederick_MD/Clean_Water|clean water]]. <br />
<br />
In order to optimize the growth conditions in the anaerobic chamber of the fuel cell, a fluorescent protein marker will be added so to visualize bacterial growth under different conditions. <br />
<br />
We plan to accomplish this using the [[Team:FHS_Frederick_MD/NirB_Promoter|NirB oxygen-sensitive promoter]] to induce expression of the glowing gene only when oxygen is scarce. Furthermore, we must engineer a fluorescent [[Team:FHS_Frederick_MD/LOV_Domain|LOV domain]], which is optimized for expression in ''S. oneidensis'' and capable of fluorescence under anaerobic conditions. <br />
<br />
This genetic construct will help us ensure that the bacteria are actually growing under anaerobic conditions. This would lead to the creation of a BioBrick that can be deposited back into the “toolbox” parts repository for future iGEM teams.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/HeaderTeam:FHS Frederick MD/Header2014-06-21T01:41:02Z<p>Rozakd: </p>
<hr />
<div>__NOTOC__<br />
[[File:FHS_Logo.png|center|500px]]<br />
<br />
<html lang="en"> <br />
<br />
<head><br />
<style type="text/css"><br />
<br />
/*<br />
This header was adapted from the header developed by Team:Sharon_MA_Aquila in 2012<br />
*/<br />
<br />
#globalwrapper <br />
{<br />
width:975px;<br />
padding:20px 0px;<br />
margin: 0 auto;<br />
background-color:#ffffff;<br />
height:100%;<br />
}<br />
<br />
.firstHeading <br />
{<br />
height:0px;<br />
visibility:hidden;<br />
}<br />
<br />
body <br />
{<br />
/* background-image: url('http://img85.imageshack.us/img85/8767/tileskynew.jpg'); */<br />
background-position: center;<br />
}<br />
<br />
#p-logo <br />
{<br />
height:1px; overflow:hidden; display: none;<br />
}<br />
<br />
#top-section <br />
{<br />
background: #ffffff;<br />
/* background-image: url('http://img4.imageshack.us/img4/549/igemheader.jpg'); */<br />
background-position: top;<br />
height:20px ;<br />
background-repeat: no-repeat;<br />
border-width:0px;<br />
border-top-width:1px;<br />
<br />
}<br />
<br />
#content <br />
{<br />
border-left-width:0px;<br />
border-right-width:0px;<br />
padding:5px;<br />
width:965px;<br />
}<br />
<br />
#menubar <br />
{ <br />
background-color: white; <br />
}<br />
<br />
#menubar ul li a <br />
{ <br />
color: #999999; }<br />
.right-menu li a {<br />
color: black;<br />
background-color: white;<br />
}<br />
<br />
</style><br />
</head><br />
<br />
<body><br />
<html><br />
<head><br />
<meta><br />
<style><br />
<br />
#navbar <br />
{<br />
margin: 1600;<br />
padding: 0;<br />
height: 1em; <br />
position: relative;<br />
//left: 80px;<br />
}<br />
#navbar a:hover <br />
{<br />
background-color:#033EAB; <!navbar hover color><br />
text-decoration:underline;<br />
}<br />
#navbar li <br />
{<br />
list-style: none;<br />
float: left; <br />
}<br />
#navbar li a <br />
{<br />
padding-left: 10px;<br />
padding-bottom: 2px;<br />
padding-right: 10px;<br />
padding-top: 2px;<br />
display: block;<br />
// background-color: #002261;<br />
background-color: black;<br />
color: yellow;<br />
text-decoration: none; <br />
border-right:2px solid yellow;<br />
}<br />
#navbar li ul <br />
{<br />
display: none; <br />
width: 12em;<br />
background-color: #000000;<br />
}<br />
#navbar li:hover ul, #navbar li.hover ul <br />
{<br />
display: block;<br />
position: absolute;<br />
background-color: #ffffff;<br />
margin: 0;<br />
padding: 0; <br />
}<br />
#navbar li:hover li, #navbar li.hover li <br />
{<br />
float: none; <br />
}<br />
#navbar li:hover li a, #navbar li.hover li a <br />
{<br />
// background-color: #002261; /*Dropdown color*/<br />
background-color: black;<br />
color: white; <br />
}<br />
#navbar li li a:hover <br />
{<br />
background-color: #033EAB; <br />
}<br />
</style><br />
<br />
<script><br />
// Javascript originally by Patrick Griffiths and Dan Webb.<br />
// http://htmldog.com/articles/suckerfish/dropdowns/<br />
<br />
sfHover = function() <br />
{<br />
var sfEls = document.getElementById("navbar").getElementsByTagName("li");<br />
for (var i=0; i<sfEls.length; i++) <br />
{<br />
sfEls[i].onmouseover=function() <br />
{<br />
this.className+=" hover";<br />
}<br />
sfEls[i].onmouseout=function() <br />
{<br />
this.className=this.className.replace(new RegExp(" hover\\b"), "");<br />
}<br />
}<br />
}<br />
<br />
if (window.attachEvent) window.attachEvent("onload", sfHover);<br />
<br />
</script><br />
<br />
</head><br />
<br />
</a><br />
<br />
<body><br />
<div id="wrap"><br />
<center><br />
<table><br />
<tr><br />
<td><br />
<ul id="navbar"><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Members">TEAM</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Members">Members</a></li><br />
<li><a href="https://igem.org/Team.cgi?year=2014&division=high_school&team_name=FHS_Frederick_MD">Official Profile</a></li><br />
</ul><br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">PROJECT</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">Overview</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Microbial_Fuel_Cells">Microbial Fuel Cells</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/NirB_Promoter">NirB Promoter</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/LOV_Domain">LOV Domain</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">RESEARCH</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">Materials and Methods</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Notebook">Lab Notebook</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Safety">Safety</a></li> <br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">RESULTS</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">Transformations</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Electrophoresis">Electrophoresis</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sequencing">Sequencing</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Outlook">Outlook</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/HumanPractices">HUMAN PRACTICES</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Renewable_Energy">Renewable Energy</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Clean_Water">Clean Water</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Basic_Research">Basic Research</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Public_Awareness">Public Awareness</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sponsors">SPONSORS</a> </li><br />
</ul><br />
</td><br />
</tr><br />
</table> </center><br />
</div><br />
<br />
</body><br />
<br />
<br />
<!--navigation menu--><br />
<ul class="navbar"><br />
<br />
<br />
</ul><br />
<br />
</body><br />
</html><br />
<br />
<br />
<html lang="en"> <br />
<head><br />
<style type="text/css"><br />
<br />
#col_left<br />
{<br />
float: left;<br />
width: 576px;<br />
padding: 30px 0px;<br />
margin:0;<br />
}<br />
<br />
#col_right<br />
{<br />
float: right;<br />
width: 242px;<br />
padding: 30px 28px 30px 15px;<br />
margin:0;<br />
}<br />
<br />
#col_center<br />
{<br />
float: center;<br />
width: 576;<br />
padding: 0px 100px;<br />
margin:0;<br />
}<br />
#col_nav<br />
{<br />
float: left;<br />
width: 200px;<br />
padding: 30px 15px 30px 50px;<br />
margin:0;<br />
}<br />
<br />
#block-content<br />
{<br />
padding-bottom: 15px;<br />
clear:both;<br />
}<br />
<br />
</style><br />
</head><br />
</html><br />
<div id="col_center"><br />
<div id="block-content"><br />
</div><!--end block-content--></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/HeaderTeam:FHS Frederick MD/Header2014-06-21T01:40:21Z<p>Rozakd: </p>
<hr />
<div>__NOTOC__<br />
[[File:FHS_Logo.png|center|500px]]<br />
<br />
<html lang="en"> <br />
<br />
<head><br />
<style type="text/css"><br />
<br />
/*<br />
This header was adapted from the header developed by Team:Sharon_MA_Aquila in 2012<br />
*/<br />
<br />
#globalwrapper <br />
{<br />
width:975px;<br />
padding:20px 0px;<br />
margin: 0 auto;<br />
background-color:#ffffff;<br />
height:100%;<br />
}<br />
<br />
.firstHeading <br />
{<br />
height:0px;<br />
visibility:hidden;<br />
}<br />
<br />
body <br />
{<br />
/* background-image: url('http://img85.imageshack.us/img85/8767/tileskynew.jpg'); */<br />
background-position: center;<br />
}<br />
<br />
#p-logo <br />
{<br />
height:1px; overflow:hidden; display: none;<br />
}<br />
<br />
#top-section <br />
{<br />
background: #ffffff;<br />
/* background-image: url('http://img4.imageshack.us/img4/549/igemheader.jpg'); */<br />
background-position: top;<br />
height:20px ;<br />
background-repeat: no-repeat;<br />
border-width:0px;<br />
border-top-width:1px;<br />
<br />
}<br />
<br />
#content <br />
{<br />
border-left-width:0px;<br />
border-right-width:0px;<br />
padding:5px;<br />
width:965px;<br />
}<br />
<br />
#menubar <br />
{ <br />
background-color: white; <br />
}<br />
<br />
#menubar ul li a <br />
{ <br />
color: #999999; }<br />
.right-menu li a {<br />
color: black;<br />
background-color: white;<br />
}<br />
<br />
</style><br />
</head><br />
<br />
<body><br />
<html><br />
<head><br />
<meta><br />
<style><br />
<br />
#navbar <br />
{<br />
margin: 1600;<br />
padding: 0;<br />
height: 1em; <br />
position: relative;<br />
//left: 80px;<br />
}<br />
#navbar a:hover <br />
{<br />
background-color:#033EAB; <!navbar hover color><br />
text-decoration:underline;<br />
}<br />
#navbar li <br />
{<br />
list-style: none;<br />
float: left; <br />
}<br />
#navbar li a <br />
{<br />
padding-left: 10px;<br />
padding-bottom: 2px;<br />
padding-right: 10px;<br />
padding-top: 2px;<br />
display: block;<br />
// background-color: #002261;<br />
background-color: black;<br />
color: yellow;<br />
text-decoration: none; <br />
border-right:2px solid yellow;<br />
}<br />
#navbar li ul <br />
{<br />
display: none; <br />
width: 12em;<br />
background-color: #000000;<br />
}<br />
#navbar li:hover ul, #navbar li.hover ul <br />
{<br />
display: block;<br />
position: absolute;<br />
background-color: #ffffff;<br />
margin: 0;<br />
padding: 0; <br />
}<br />
#navbar li:hover li, #navbar li.hover li <br />
{<br />
float: none; <br />
}<br />
#navbar li:hover li a, #navbar li.hover li a <br />
{<br />
// background-color: #002261; /*Dropdown color*/<br />
background-color: black;<br />
color: white; <br />
}<br />
#navbar li li a:hover <br />
{<br />
background-color: #033EAB; <br />
}<br />
</style><br />
<br />
<script><br />
// Javascript originally by Patrick Griffiths and Dan Webb.<br />
// http://htmldog.com/articles/suckerfish/dropdowns/<br />
<br />
sfHover = function() <br />
{<br />
var sfEls = document.getElementById("navbar").getElementsByTagName("li");<br />
for (var i=0; i<sfEls.length; i++) <br />
{<br />
sfEls[i].onmouseover=function() <br />
{<br />
this.className+=" hover";<br />
}<br />
sfEls[i].onmouseout=function() <br />
{<br />
this.className=this.className.replace(new RegExp(" hover\\b"), "");<br />
}<br />
}<br />
}<br />
<br />
if (window.attachEvent) window.attachEvent("onload", sfHover);<br />
<br />
</script><br />
<br />
</head><br />
<br />
</a><br />
<br />
<body><br />
<div id="wrap"><br />
<center><br />
<table><br />
<tr><br />
<td><br />
<ul id="navbar"><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Members">TEAM</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Members">Members</a></li><br />
<li><a href="https://igem.org/Team.cgi?year=2014&division=high_school&team_name=FHS_Frederick_MD">Official Profile</a></li><br />
</ul><br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">PROJECT</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">Overview</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Microbial_Fuel_Cells">Microbial Fuel Cells</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/NirB_Promoter">NirB Promoter</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/LOV_Domain">LOV Domain</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">RESEARCH</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">Materials and Methods</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Notebook">Lab Notebook</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Safety">Safety</a></li> <br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">RESULTS</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">Transformations</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Electrophoresis">Electrophoresis</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sequencing">Sequencing</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Outlook">Outlook</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/HumanPractices">HUMAN PRACTICES</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Renewable_Energy">Renewable Energy</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Clean_Water">Clean Water</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Basic_Research">Basic Research</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Public_Awareness">Public Awareness</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sponsors">SPONSORS</a> </li><br />
</ul><br />
</td><br />
</tr><br />
</table> </center><br />
</div><br />
<br />
</body><br />
<br />
<br />
<!--navigation menu--><br />
<ul class="navbar"><br />
<br />
<br />
</ul><br />
<br />
</body><br />
</html><br />
<br />
<br />
<html lang="en"> <br />
<head><br />
<style type="text/css"><br />
<br />
#col_left<br />
{<br />
float: left;<br />
width: 576px;<br />
padding: 30px 0px;<br />
margin:0;<br />
}<br />
<br />
#col_right<br />
{<br />
float: right;<br />
width: 242px;<br />
padding: 30px 28px 30px 15px;<br />
margin:0;<br />
}<br />
<br />
#col_center<br />
{<br />
float: center;<br />
width: 576;<br />
padding: 30px -50px;<br />
margin:0;<br />
}<br />
#col_nav<br />
{<br />
float: left;<br />
width: 200px;<br />
padding: 30px 15px 30px 50px;<br />
margin:0;<br />
}<br />
<br />
#block-content<br />
{<br />
padding-bottom: 15px;<br />
clear:both;<br />
}<br />
<br />
</style><br />
</head><br />
</html><br />
<div id="col_center"><br />
<div id="block-content"><br />
</div><!--end block-content--></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/HeaderTeam:FHS Frederick MD/Header2014-06-21T01:39:36Z<p>Rozakd: Trying to reduce spacing beneath header</p>
<hr />
<div>__NOTOC__<br />
[[File:FHS_Logo.png|center|500px]]<br />
<br />
<html lang="en"> <br />
<br />
<head><br />
<style type="text/css"><br />
<br />
/*<br />
This header was adapted from the header developed by Team:Sharon_MA_Aquila in 2012<br />
*/<br />
<br />
#globalwrapper <br />
{<br />
width:975px;<br />
padding:20px 0px;<br />
margin: 0 auto;<br />
background-color:#ffffff;<br />
height:100%;<br />
}<br />
<br />
.firstHeading <br />
{<br />
height:0px;<br />
visibility:hidden;<br />
}<br />
<br />
body <br />
{<br />
/* background-image: url('http://img85.imageshack.us/img85/8767/tileskynew.jpg'); */<br />
background-position: center;<br />
}<br />
<br />
#p-logo <br />
{<br />
height:1px; overflow:hidden; display: none;<br />
}<br />
<br />
#top-section <br />
{<br />
background: #ffffff;<br />
/* background-image: url('http://img4.imageshack.us/img4/549/igemheader.jpg'); */<br />
background-position: top;<br />
height:20px ;<br />
background-repeat: no-repeat;<br />
border-width:0px;<br />
border-top-width:1px;<br />
<br />
}<br />
<br />
#content <br />
{<br />
border-left-width:0px;<br />
border-right-width:0px;<br />
padding:5px;<br />
width:965px;<br />
}<br />
<br />
#menubar <br />
{ <br />
background-color: white; <br />
}<br />
<br />
#menubar ul li a <br />
{ <br />
color: #999999; }<br />
.right-menu li a {<br />
color: black;<br />
background-color: white;<br />
}<br />
<br />
</style><br />
</head><br />
<br />
<body><br />
<html><br />
<head><br />
<meta><br />
<style><br />
<br />
#navbar <br />
{<br />
margin: 1600;<br />
padding: 0;<br />
height: 1em; <br />
position: relative;<br />
//left: 80px;<br />
}<br />
#navbar a:hover <br />
{<br />
background-color:#033EAB; <!navbar hover color><br />
text-decoration:underline;<br />
}<br />
#navbar li <br />
{<br />
list-style: none;<br />
float: left; <br />
}<br />
#navbar li a <br />
{<br />
padding-left: 10px;<br />
padding-bottom: 2px;<br />
padding-right: 10px;<br />
padding-top: 2px;<br />
display: block;<br />
// background-color: #002261;<br />
background-color: black;<br />
color: yellow;<br />
text-decoration: none; <br />
border-right:2px solid yellow;<br />
}<br />
#navbar li ul <br />
{<br />
display: none; <br />
width: 12em;<br />
background-color: #000000;<br />
}<br />
#navbar li:hover ul, #navbar li.hover ul <br />
{<br />
display: block;<br />
position: absolute;<br />
background-color: #ffffff;<br />
margin: 0;<br />
padding: 0; <br />
}<br />
#navbar li:hover li, #navbar li.hover li <br />
{<br />
float: none; <br />
}<br />
#navbar li:hover li a, #navbar li.hover li a <br />
{<br />
// background-color: #002261; /*Dropdown color*/<br />
background-color: black;<br />
color: white; <br />
}<br />
#navbar li li a:hover <br />
{<br />
background-color: #033EAB; <br />
}<br />
</style><br />
<br />
<script><br />
// Javascript originally by Patrick Griffiths and Dan Webb.<br />
// http://htmldog.com/articles/suckerfish/dropdowns/<br />
<br />
sfHover = function() <br />
{<br />
var sfEls = document.getElementById("navbar").getElementsByTagName("li");<br />
for (var i=0; i<sfEls.length; i++) <br />
{<br />
sfEls[i].onmouseover=function() <br />
{<br />
this.className+=" hover";<br />
}<br />
sfEls[i].onmouseout=function() <br />
{<br />
this.className=this.className.replace(new RegExp(" hover\\b"), "");<br />
}<br />
}<br />
}<br />
<br />
if (window.attachEvent) window.attachEvent("onload", sfHover);<br />
<br />
</script><br />
<br />
</head><br />
<br />
</a><br />
<br />
<body><br />
<div id="wrap"><br />
<center><br />
<table><br />
<tr><br />
<td><br />
<ul id="navbar"><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Members">TEAM</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Members">Members</a></li><br />
<li><a href="https://igem.org/Team.cgi?year=2014&division=high_school&team_name=FHS_Frederick_MD">Official Profile</a></li><br />
</ul><br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">PROJECT</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD">Overview</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Microbial_Fuel_Cells">Microbial Fuel Cells</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/NirB_Promoter">NirB Promoter</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/LOV_Domain">LOV Domain</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">RESEARCH</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_Methods">Materials and Methods</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Notebook">Lab Notebook</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Safety">Safety</a></li> <br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">RESULTS</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Transformations">Transformations</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Electrophoresis">Electrophoresis</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sequencing">Sequencing</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Outlook">Outlook</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/HumanPractices">HUMAN PRACTICES</a><br />
<ul><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Renewable_Energy">Renewable Energy</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Clean_Water">Clean Water</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Basic_Research">Basic Research</a></li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Public_Awareness">Public Awareness</a></li><br />
</ul> <br />
</li><br />
<li><a href="https://2014hs.igem.org/Team:FHS_Frederick_MD/Sponsors">SPONSORS</a> </li><br />
</ul><br />
</td><br />
</tr><br />
</table> </center><br />
</div><br />
<br />
</body><br />
<br />
<br />
<!--navigation menu--><br />
<ul class="navbar"><br />
<br />
<br />
</ul><br />
<br />
</body><br />
</html><br />
<br />
<br />
<html lang="en"> <br />
<head><br />
<style type="text/css"><br />
<br />
#col_left<br />
{<br />
float: left;<br />
width: 576px;<br />
padding: 30px 0px;<br />
margin:0;<br />
}<br />
<br />
#col_right<br />
{<br />
float: right;<br />
width: 242px;<br />
padding: 30px 28px 30px 15px;<br />
margin:0;<br />
}<br />
<br />
#col_center<br />
{<br />
float: center;<br />
width: 576;<br />
//padding: 30px 100px;<br />
margin:0;<br />
}<br />
#col_nav<br />
{<br />
float: left;<br />
width: 200px;<br />
padding: 30px 15px 30px 50px;<br />
margin:0;<br />
}<br />
<br />
#block-content<br />
{<br />
padding-bottom: 15px;<br />
clear:both;<br />
}<br />
<br />
</style><br />
</head><br />
</html><br />
<div id="col_center"><br />
<div id="block-content"><br />
</div><!--end block-content--></div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/SponsorsTeam:FHS Frederick MD/Sponsors2014-06-21T01:35:29Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
{| cellpadding="20"<br />
|[[File:ABT_Logo.jpg|link=http://arsbiotechnica.org|175px]]<br />
|style="vertical-align:top;"| [http://arsbiotechnica.org Ars Biotechnica] is a nonprofit profit organization, which was established by our mentors, to help our high school and others build and maintain synthetic biology labs.<br />
|-<br />
|[[File:CRM-logo.png|link=http://www.clinicalrm.com|175px]]<br />
|style="vertical-align:top;"| [http://www.clinicalrm.com/ Clinical RM] helped our team purchase needed equipment and supplies when we were just starting up.<br />
|-<br />
|[[File:BNBL_Logo.jpg|link=http://bnbi.org|175px]]<br />
|style="vertical-align:top;"| [http://bnbi.org The Battelle National Biodefense Institute] helped cover our iGEM registration costs.<br />
|-<br />
|[[File:NEB_Logo.jpg|link=http://neb.com|175px]]<br />
|style="vertical-align:top;"| [http://neb.com New England Biolabs] provided our team with many of the enzymes and reagents we needed to for this project.<br />
|}<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Public_AwarenessTeam:FHS Frederick MD/Public Awareness2014-06-21T01:34:51Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Public Awareness=<br />
[[File:cardin.jpg|right|300px]]This year the Frederick High Bioengineering Club is not only on the fast track to Boston but also to recognition. Purely through word of mouth Maryland Senator Ben Cardin came to Frederick High to visit with the group. <br />
<br />
The team presented their research on biofuel cells from the previous years, explained in detail why they won their division at last year's Frederick County science fair, and described what they were currently working on. <br />
<br />
Thanks to Senator Cardin's interest in our budding iGEM team, we received some local news coverage. Given this opportunity, the team members took the time to also highlight the importance of STEM, expressing how STEM programs such as AP Biology, Chemistry, Environmental Science, and Calculus were great opportunities for students to get their feet wet and explore STEM. <br />
<br />
This media coverage provoked the local Career and Technology center at Frederick Community College to consider making their own iGEM teams with the aid of the non profit organization created by team mentors Mark Trice, Dave Rozak, and Gary Lopez. <br />
<br />
The [http://www.fredericknewspost.com/news/education/education_topics/learning/genetic-research-sparks-science-careers-at-frederick-high/article_a221dc2d-6208-58b9-b45f-7aed61b37ce3.html Frederick News Posts] covered Senator Cardin's time with the iGEMs group. <br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Basic_ResearchTeam:FHS Frederick MD/Basic Research2014-06-21T01:34:20Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Basic Research=<br />
We hope that our team and others will can use our oxygen-sensitive reporter system to improve ''S. oneidensis'' growth and microbial fuel cell design.<br />
<br />
For example, researchers could use our fluorescent protein to study the length of time it takes from initial placement of the bacteria in the fuel cell until electrical energy is generated. Researchers could also use the gene to determine the optimal bacterial concentration that needs to be implemented in order to maximize energy output.<br />
<br />
With the glowing protein, researchers may be able to formulate the optimal growth media for the bacteria. Certain media may generate more electricity or more nutrients may need to be added in order to maximize performance. Farmers may also be able to look at what crops produce certain nutrients and then plan from there as to how to generate electricity from the fermentation of these plants.<br />
<br />
The gene could also be used to study methods for increasing electrical output on a larger scale and thus increasing fuel cell performance.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Clean_WaterTeam:FHS Frederick MD/Clean Water2014-06-21T01:33:55Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Clean Water=<br />
In addition to representing an affordable source of renewable energy, two-chamber microbial fuel cells produce water as a natural byproduct of the chemical reaction that takes place between oxygen, hydrogen, and electrons in the cathode chamber. The clean water produced by microbial fuel cells could be just as important as energy to people living in environments where drinking water is hard to come by. This is another reason why we chose to focus our efforts on developing a cheap and efficient microbial fuel cell.<br />
<br />
We hope that the oxygen-sensitive fluorescent operon, which we've worked on this year, will help ourselves and others reach this goal.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Renewable_EnergyTeam:FHS Frederick MD/Renewable Energy2014-06-21T01:33:28Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Renewable Energy=<br />
<br />
The renewable energy being produced by the fuel cell is the electricity. With the growing epidemic of energy scarcity, this production of a clean renewable source of energy with readily available use of nutrients is a unique answer to an age-old problem. The microbial fuel cell produces electricity by converting cellular energy released during metabolic reactions into electrical energy. This is due to bacteria growing on a negative electrode, as long as there is waste for the bacteria to consume electricity will continue to produce. An alternative fuel that is produce by microbial fuel cells is hydrogen in an anaerobic environment. The waste eating bacteria can also be in lakes to clean from organic pollutants benzene and toluene.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/HumanPracticesTeam:FHS Frederick MD/HumanPractices2014-06-21T01:32:47Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Human Practices=<br />
As renewable energy and alternative energy resources have become more and more important in the world we live in today, answers, not suggestions, must be found. The research we enacted will allow naturally-occurring bacteria in the soil to generate electricity, rather than traditional methods, such as coal. Through the genetic engineering of the bacteria, we will be able to enhance the bacteria's ability to deposit electrons on the electrodes to produce electricity.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/OutlookTeam:FHS Frederick MD/Outlook2014-06-21T01:32:21Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Outlook=<br />
This year's experiments have resulted in minor setbacks and major successes. In our endeavors we have successfully combined the LOV fluorescent domain into our plasmid pSB1C3. The following years remain bright with possibilities. In years following this, future iGEMs members will succeed where we have failed, in which they will unite NirB and pSBLC3. Such completion would lead to the union of two plasmids through combining the promoter and LOV gene. Thus reaching our stride by placing our gene into ''Shewanella oneidensis'' to create our anaerobic/bacterial growth indicator. Future members will continue our work and research until a proficient fuel cell is created. Given our dedication and desire to succeed we hope to see our members bringing a functioning fuel cell into iGEM 2020.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/SequencingTeam:FHS Frederick MD/Sequencing2014-06-21T01:31:52Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Sequencing=<br />
<br />
In the last week of school, as classes were winding down, we sent our plasmid samples out for sequencing using the BioBrick standard forward sequencing primer (FV2). Our first shot at sequencing the samples yielded poor results because our template concentration was too high.<br />
<br />
We quickly resubmitted another set of samples and this time asked the company to adjust the template concentrations prior to sequencing. This yielded good results with mixed outcomes.<br />
<br />
'''The bad news:''' None of the five pSB1C3/NirB transformants showed signs of having integrated the NirB promoter. We are in the process of considering what went wrong and how to get better results next time.<br />
<br />
'''The good news:''' We were thrilled to discover that both of the pSB1C3/LOV plasmid samples had successfully incorporated our re-engineered copy of the LOV gene. While other teams have made BioBricks containing the NirB oxygen sensitive promoters ([http://parts.igem.org/Part:BBa_K763002 BBa_K763002]), we believe we were the first to create a BioBrick containing an optimized version of the LOV domain, which should have better fluorescent properties than green fluorescent protein in anaerobic environments.<br />
<br />
The following sequence alignment shows consensus among the engineered LOV domain and the two cloned plasmid inserts (002-027-06 and 002-027-08).<br />
<br />
<br />
<pre><br />
CLUSTAL 2.1 multiple sequence alignment<br />
<br />
LOV --------------------------------------------GAATTC 14<br />
02-027-08-VF2_D11.ab1 TTCNGATAAAAAAAATCCTTAGCTTTCGCNANNGNNGATTTCTGGAATTC 100<br />
02-027-06-VF2_C11.ab1 TTCAGATAAAAAAAATCCTTAGCTTTCGCNNAGGANGATTTCTGGAATTC 99<br />
******<br />
<br />
LOV GCGGCCGCTTCTAGAGATGGCTTCTTTCCAATCTTTCGGTATCCCAGGTC 64<br />
02-027-08-VF2_D11.ab1 GCGGCCGCTTCTAGAGATGGCTTCTTTCCAATCTTTCGGTATCCCAGGTC 150<br />
02-027-06-VF2_C11.ab1 GCGGCCGCTTCTAGAGATGGCTTCTTTCCAATCTTTCGGTATCCCAGGTC 149<br />
**************************************************<br />
<br />
LOV AACTGGAAGTTATCAAAAAAGCTCTGGATCACGTTCGTGTTGGTGTTGTT 114<br />
02-027-08-VF2_D11.ab1 AACTGGAAGTTATCAAAAAAGCTCTGGATCACGTTCGTGTTGGTGTTGTT 200<br />
02-027-06-VF2_C11.ab1 AACTGGAAGTTATCAAAAAAGCTCTGGATCACGTTCGTGTTGGTGTTGTT 199<br />
**************************************************<br />
<br />
LOV ATCACTGATCCAGCTCTGGAAGATAACCCAATCGTTTACGTTAACCAAGG 164<br />
02-027-08-VF2_D11.ab1 ATCACTGATCCAGCTCTGGAAGATAACCCAATCGTTTACGTTAACCAAGG 250<br />
02-027-06-VF2_C11.ab1 ATCACTGATCCAGCTCTGGAAGATAACCCAATCGTTTACGTTAACCAAGG 249<br />
**************************************************<br />
<br />
LOV TTTCGTTCAAATGACTGGTTACGAAACTGAAGAAATCCTGGGTAAAAACG 214<br />
02-027-08-VF2_D11.ab1 TTTCGTTCAAATGACTGGTTACGAAACTGAAGAAATCCTGGGTAAAAACG 300<br />
02-027-06-VF2_C11.ab1 TTTCGTTCAAATGACTGGTTACGAAACTGAAGAAATCCTGGGTAAAAACG 299<br />
**************************************************<br />
<br />
LOV CTCGTTTCCTGCAAGGTAAACACACTGATCCAGCTGAAGTTGATAACATC 264<br />
02-027-08-VF2_D11.ab1 CTCGTTTCCTGCAAGGTAAACACACTGATCCAGCTGAAGTTGATAACATC 350<br />
02-027-06-VF2_C11.ab1 CTCGTTTCCTGCAAGGTAAACACACTGATCCAGCTGAAGTTGATAACATC 349<br />
**************************************************<br />
<br />
LOV CGTACTGCTCTGCAAAACAAAGAACCAGTTACTGTTCAAATCCAAAACTA 314<br />
02-027-08-VF2_D11.ab1 CGTACTGCTCTGCAAAACAAAGAACCAGTTACTGTTCAAATCCAAAACTA 400<br />
02-027-06-VF2_C11.ab1 CGTACTGCTCTGCAAAACAAAGAACCAGTTACTGTTCAAATCCAAAACTA 399<br />
**************************************************<br />
<br />
LOV CAAAAAAGATGGTACTATGTTCTGGAACGAACTGAACATCGATCCAATGG 364<br />
02-027-08-VF2_D11.ab1 CAAAAAAGATGGTACTATGTTCTGGAACGAACTGAACATCGATCCAATGG 450<br />
02-027-06-VF2_C11.ab1 CAAAAAAGATGGTACTATGTTCTGGAACGAACTGAACATCGATCCAATGG 449<br />
**************************************************<br />
<br />
LOV AAATCGAAGATAAAACTTACTTCGTTGGTATCCAAAACGATATCACTAAA 414<br />
02-027-08-VF2_D11.ab1 AAATCGAAGATAAAACTTACTTCGTTGGTATCCAAAACGATATCACTAAA 500<br />
02-027-06-VF2_C11.ab1 AAATCGAAGATAAAACTTACTTCGTTGGTATCCAAAACGATATCACTAAA 499<br />
**************************************************<br />
<br />
LOV CAAAAAGAATACGAAAAACTGCTGGAATAATACTAGTAGCGGCCGCTGCA 464<br />
02-027-08-VF2_D11.ab1 CAAAAAGAATACGAAAAACTGCTGGAATAATACTAGTAGCGGCCGCTGCA 550<br />
02-027-06-VF2_C11.ab1 CAAAAAGAATACGAAAAACTGCTGGAATAATACTAGTAGCGGCCGCTGCA 549<br />
**************************************************<br />
<br />
LOV G---------GAAG---------------------------------AAA 472<br />
02-027-08-VF2_D11.ab1 GTCCGGCAAAAAAGGGCAAGGTGTCACCACCCTGCCCTTTTTCTTTAAAA 600<br />
02-027-06-VF2_C11.ab1 GTCCGGCAAAAAAGGGCAAGGTGTCACCACCCTGCCCTTTTTCTTTAAAA 599<br />
* *** ***<br />
</pre><br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/ElectrophoresisTeam:FHS Frederick MD/Electrophoresis2014-06-21T01:31:18Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Electrophoresis=<br />
[[File:NirBLovGel.jpg|right|300px]]<br />
<br />
As seen in the gel, the first five bands, after the DNA marker well, show that the pSB1C3/NirB plasmid was transformed and showed an appropriate size banding pattern. The next five wells represented the pSB1C3/LOV plasmid. As seen in the gel, only two samples show bands. Further experiments will need to be completed to study why transformation do not occur fully.<br />
<br />
We [[Team:FHS_Frederick_MD/Sequencing|sequenced]] those samples which showed strong bands on the gel.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/TransformationsTeam:FHS Frederick MD/Transformations2014-06-21T01:30:44Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Transformations=<br />
<br />
[[File:Transformants.jpg|right|300px]]<br />
<br />
It may be hard to see, but there were 10-50 colonies on the chloramphenicol agar plates we inoculated with pSB1C3/NirB and pSB1C3/LOV transformed ''E. coli''! We also ran a negative control and saw no sign of growth. <br />
<br />
After weeks of trying to transform commercially-produced LyoComp bacteria and homemade chemically competent ''E. coli'', the latter approach finally achieved a high enough transformation efficiency for us to propagate and test multiple clones containing our synthetic [[Team:FHS_Frederick_MD/NirB_Promoter|NirB]] and [[Team:FHS_Frederick_MD/LOV_Domain|LOV]] genes. In subsequent experiments, we subcultured five colonies from each plate, extracted the plasmid DNA, and analyzed it using [[Team:FHS_Frederick_MD/Electrophoresis|gel electrophoresis]] and [[Team:FHS_Frederick_MD/Sequencing|DNA sequencing]].<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/SafetyTeam:FHS Frederick MD/Safety2014-06-21T01:30:18Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Safety=<br />
All members were required to take a lab safety class developed and presented by one of our club members. To create a safe environment for ourselves, we went through basic safety and hazards overview for every lab. To ensure nothing was contaminated, we sterilized our work station using Q-18 disinfectant with a combination of bleach. We also used Lysol wipes on any surface in direct contact with lab materials. For personal safety, we would use Purell before and after taking off gloves. Eye protection was required in lab areas to protect eye health and safety. We also tested and confirmed that the eye wash station was completely functional before experiments were conducted. In addition, we wore lab coats that covered us from collar to knee. All hazardous materials were dealt with safely and with the environment in mind. Only iGEM-supplied ''E. coli'' were used. Loose hair was tied back. Proper supervision was a priority, with either Mark Trice or Dave Rozak present for all experiments.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/NotebookTeam:FHS Frederick MD/Notebook2014-06-21T01:29:50Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Lab Notebook=<br />
<br />
* [http://arsbiotechnica.org/w/Article:002-001 20 Feb 2014]: Received iGEM supplies<br />
* [http://arsbiotechnica.org/w/Record:002-010 03 Apr 2014]: Digested NirB and LOV inserts<br />
* [http://arsbiotechnica.org/w/Record:002-011 10 Apr 2014]: Ligated NirB and LOV genes into pSB1C3<br />
* [http://arsbiotechnica.org/w/Record:002-012 14 Apr 2014]: Transformed ''E. coli'' with LOV and NirB constructs<br />
* [http://arsbiotechnica.org/w/Record:002-013 21 Apr 2014]: Ligated NirB and LOV genes into pSB1C3<br />
* [http://arsbiotechnica.org/w/Record:002-014 28 Apr 2014]: Transformed ''E. coli'' with LOV and NirB constructs<br />
* [http://arsbiotechnica.org/w/Record:002-015 01 May 2014]: Prepared TSS buffer<br />
* [http://arsbiotechnica.org/w/Record:002-016 05 May 2014]: Ligatied the RFP plasmid<br />
* [http://arsbiotechnica.org/w/Record:002-017 08 May 2014]: Subcultured ''E. coli'' NEB10 Beta<br />
* [http://arsbiotechnica.org/w/Record:002-018 08 May 2014]: Tested transformation efficiency of competent cells<br />
* [http://arsbiotechnica.org/w/Record:002-020 12 May 2014]: Digested NirB, LOV, pSB1C3 DNA fragments with EcoRI and PstI<br />
* [http://arsbiotechnica.org/w/Record:002-021 15 May 2014]: Ligated NirB and LOV into pSB1C3<br />
* [http://arsbiotechnica.org/w/Record:002-022 20 May 2014]: Transformed ''E. coli'' with LOV and NirB constructs <br />
* [http://arsbiotechnica.org/w/Record:002-023 29 May 2014]: Cultured individual NirB and LOV colonies<br />
* [http://arsbiotechnica.org/w/Record:002-024 02 Jun 2014]: Purified NirB and LOV plasmids<br />
* [http://arsbiotechnica.org/w/Record:002-025 03 Jun 2014]: Visualized NirB and LOV plasmids on a gel<br />
* [http://arsbiotechnica.org/w/Record:002-026 04 Jun 2014]: Recultured NirB and LOV transformants<br />
* [http://arsbiotechnica.org/w/Record:002-027 05 Jun 2014]: Extracted plasmid DNA from bacterial transformants<br />
* [http://arsbiotechnica.org/w/Record:002-028 06 Jun 2014]: Observed plasmid DNA on a gel<br />
* [http://arsbiotechnica.org/w/Record:002-029 09 Jun 2014]: Submitted samples for sequencing<br />
* [http://arsbiotechnica.org/w/Record:002-030 11 Jun 2014]: Resubmitted DNA for sequencing<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Materials_and_MethodsTeam:FHS Frederick MD/Materials and Methods2014-06-21T01:29:20Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Materials and Methods=<br />
<br />
Following the direction of work completed by [http://www.nature.com/nbt/journal/v25/n4/abs/nbt1293.html Drepper et al. 2007], the LOV fluorescent gene was modified for use in this experiment by altering one amino acid in the protein increasing the illumination given by the bacteria compared to the wild type gene. The increased fluorescence of the bacterial colonies makes the bacterial growth within the fuel cell easier to monitor. <br />
<br />
The NirB gene has already been synthesized by other iGEM teams ([http://parts.igem.org/Part:BBa_K763002 BBa_K763002]) and was reproduced here only by adding a prefix and suffix nucleotide strain in order to use it in the 3A Assembly process. The LOV gene also received this same prefix and suffix sequence. Please see our [[Team:FHS_Frederick_MD/Project|project section]] for details on how the [[Team:FHS_Frederick_MD/LOV_Domain|LOV]] and [[Team:FHS_Frederick_MD/NirB_Promoter|NirB]] genes were designed.<br />
<br />
Each engineered gene was synthesized as an IDT gBlock fragment and incorporated into the pSB1C3 construction plasmid by cutting each with restriction enzymes followed by ligation. <br />
<br />
After different plasmids containing one of the genes were made they were propagated in separate ''E. coli'' bacterial colonies. Each strain was cultivated in a liquid broth and centrifuged to concentrate a bacterial pellet. <br />
<br />
The DNA was then extracted from the bacteria and purified using QIAprep purification kit. Before continuing we had to confirm the incorporation of the plasmid into the bacterial DNA so a sample was run through gel electrophoresis. <br />
<br />
Finally, the plasmids were submitted for sequencing. The plasmid containing the LOV gene was successful with the proper DNA sequence present. However, the plasmid with the NirB gene failed to form properly so we were unable to complete the 3A assembly process to then combine those plasmids. This will become a future project for our group in order to continue fashioning a more effective microbial fuel cell.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/LOV_DomainTeam:FHS Frederick MD/LOV Domain2014-06-21T01:28:51Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=LOV Domain=<br />
LOV stands for light oxygen voltage. It is a sensor protein that detects the presence of blue light (365 nm). In its wild type form it is used by higher plants, fungi, and bacteria. In higher plants LOV controls phototropism and chloroplasts relocation. In this form it absorbs blue light (365 nm) and in the wild state flavin mononucleotides (FMN) link to cysteine. This results in LOV not being able to efficiently emit green light (495 nm) due to FMN.<br />
<br />
We choose to modify LOV as our anaerobic environment and growth indicator. We choose LOV over green fluorescent proteins (GFP) due to the fact that GFPs are completely dependant on molecular oxygen to glow. However, due to FMN, LOV cannot release green light (495 nm). <br />
<br />
Thomas Drepper found a solution to this problem. Drepper and his fellow researchers realized the effects of FMN and found away to remove it. By eliminating the LOV domain's cysteine amino acid, FMN had nothing to bind to. <br />
<br />
Following Drepper's model we replaced the cysteine amino acid at position 62 of the ''Bacillus subtilis''-derived LOV domain with an alanine:<br />
<br />
<pre><br />
001 MASFQSFGIP GQLEVIKKAL DHVRVGVVIT DPALEDNPIV YVNQGFVQMT GYETEEILGK<br />
061 NARFLQGKHT DPAEVDNIRT ALQNKEPVTV QIQNYKKDGT MFWNELNIDP MEIEDKTYFV<br />
121 GIQNDITKQK<br />
</pre><br />
<br />
This is where our models departed. Instead of optimizing our gene for ''E.coli'', we choose to optimize codon usage for ''S. oneidensis''. We used the online [http://www.jcat.de/ Java Codon Adaptation Tool] to create a DNA sequence which has been optimized for our use in the following ways:<br />
* Optimized for ''S. oneidensis'' codon usage.<br />
* Avoids use of the four 3A Assembly restriction enzymes: EcoRI, SpeI, XbaI, PstI.<br />
* Avoids internal prokaryotic ribosome binding sites.<br />
<br />
When using these parameters, JCAT produces the following nucleic acid sequence:<br />
<br />
<pre><br />
ATGGCTTCTTTCCAATCTTTCGGTATCCCAGGTCAATTAGAAGTTATCAA 50<br />
AAAAGCTTTAGATCACGTTCGTGTTGGTGTTGTTATCACTGATCCAGCTT 100<br />
TAGAAGATAACCCAATCGTTTACGTTAACCAAGGTTTCGTTCAAATGACT 150<br />
GGTTACGAAACTGAAGAAATCTTAGGTAAAAACGCTCGTTTCTTACAAGG 200<br />
TAAACACACTGATCCAGCTGAAGTTGATAACATCCGTACTGCTTTACAAA 250<br />
ACAAAGAACCAGTTACTGTTCAAATCCAAAACTACAAAAAAGATGGTACT 300<br />
ATGTTCTGGAACGAATTAAACATCGATCCAATGGAAATCGAAGATAAAAC 350<br />
TTACTTCGTTGGTATCCAAAACGATATCACTAAACAAAAAGAATACGAAA 400<br />
AATTATTAGAA<br />
</pre><br />
<br />
Finally, we added a TAA stop codon to the end of the sequence to ensure termination of the translation.<br />
<br />
We used the sequence alignment tool to confirm that this was in fact the correct gene. The result show an exact match.<br />
<br />
<pre><br />
100.0% identity in 137 residues overlap; Score: 712.0; Gap frequency: 0.0%<br />
<br />
Intended 1 MASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGK<br />
Translated 1 MASFQSFGIPGQLEVIKKALDHVRVGVVITDPALEDNPIVYVNQGFVQMTGYETEEILGK<br />
************************************************************<br />
<br />
Intended 61 NARFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFV<br />
Translated 61 NARFLQGKHTDPAEVDNIRTALQNKEPVTVQIQNYKKDGTMFWNELNIDPMEIEDKTYFV<br />
************************************************************<br />
<br />
Intended 121 GIQNDITKQKEYEKLLE<br />
Translated 121 GIQNDITKQKEYEKLLE<br />
*****************<br />
</pre><br />
<br />
We used an ''E. coli'' codon usage application to see how well it will do in the bacteria. This analysis shows that there are multiple occurrences of the codon TTA (for leucine) which is poorly expressed in ''E. coli''. The next most common Leucine codon in ''Shewanella'' is CTG, which is also well tolerated in ''E. coli''. The following sequence replaces every instance of the Leucine TTA codon with CTG:<br />
<br />
<pre><br />
atggcttctttccaatctttcggtatcccaggtcaactggaagttatcaaaaaagctctg<br />
M A S F Q S F G I P G Q L E V I K K A L<br />
gatcacgttcgtgttggtgttgttatcactgatccagctctggaagataacccaatcgtt<br />
D H V R V G V V I T D P A L E D N P I V<br />
tacgttaaccaaggtttcgttcaaatgactggttacgaaactgaagaaatcctgggtaaa<br />
Y V N Q G F V Q M T G Y E T E E I L G K<br />
aacgctcgtttcctgcaaggtaaacacactgatccagctgaagttgataacatccgtact<br />
N A R F L Q G K H T D P A E V D N I R T<br />
gctctgcaaaacaaagaaccagttactgttcaaatccaaaactacaaaaaagatggtact<br />
A L Q N K E P V T V Q I Q N Y K K D G T<br />
atgttctggaacgaactgaacatcgatccaatggaaatcgaagataaaacttacttcgtt<br />
M F W N E L N I D P M E I E D K T Y F V<br />
ggtatccaaaacgatatcactaaacaaaaagaatacgaaaaactgctggaataa<br />
</pre><br />
<br />
We also added the following terminal restriction sites to allow our LOV gene to be comparable with the 3A assembly process.<br />
<br />
<pre><br />
Prefix<br />
5' GTTTCTTCGAATTCGCGGCCGCTTCTAGAG[part] 3'<br />
Suffix<br />
5' [part]TACTAGTAGCGGCCGCTGCAGGAAGAAAC 3'<br />
</pre><br />
<br />
To check over our work we also ran the sequence through the [[http://tools.neb.com/NEBcutter2/index.php NEB Cutter]] to ensure that the 3A assembly restriction sites are correctly located at the ends of the sequence and not elsewhere within the open reading frame. The results show that the restriction sites are present where required and not elsewhere.<br />
<br />
This is the BioBrick-formatted, ''Shewanella''-optimized, gene we ordered from the sequencing company for insertion into the pSB1C3 plasmid:<br />
<br />
<pre><br />
>LOV<br />
GTTTCTTCGA ATTCGCGGCC GCTTCTAGAG atggcttctt tccaatcttt <br />
cggtatccca ggtcaactgg aagttatcaa aaaagctctg gatcacgttc <br />
gtgttggtgt tgttatcact gatccagctc tggaagataa cccaatcgtt <br />
tacgttaacc aaggtttcgt tcaaatgact ggttacgaaa ctgaagaaat <br />
cctgggtaaa aacgctcgtt tcctgcaagg taaacacact gatccagctg <br />
aagttgataa catccgtact gctctgcaaa acaaagaacc agttactgtt <br />
caaatccaaa actacaaaaa agatggtact atgttctgga acgaactgaa <br />
catcgatcca atggaaatcg aagataaaac ttacttcgtt ggtatccaaa <br />
acgatatcac taaacaaaaa gaatacgaaa aactgctgga ataaTACTAG <br />
TAGCGGCCGC TGCAGGAAGA AAC<br />
</pre><br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/NirB_PromoterTeam:FHS Frederick MD/NirB Promoter2014-06-21T01:28:19Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=NirB Promoter=<br />
The NirB gene is reliant on a fumarate and nitrate reductase (FNR), which allows the promoter to activate when there is no oxygen present, as well as facilitate regulation of transcription that is responsible for the growth under anaerobic conditions. When oxygen is not present, the 4Fe-4S complex helps join two FNR components. As this happens, it becomes a protein complex that attaches to the NirB promoter part of the DNA, which results in the production of the [[Team:FHS_Frederick_MD/LOV_Domain|LOV protein]]. <br />
<br />
In an experiment by the 2012 Valencia Biocampus iGEM team (see [http://parts.igem.org/Part:BBa_K763002 BBa_K763002]), sterile oil was glossed over the tube containing the bacteria. The bacteria were then able to use the oxygen until the levels were completely depleted, resulting in a fully anaerobic environment. Once fully anaerobic, the bacteria began to produce the team's fluorescent gene product, which was under the control of the NirB promoter.<br />
<br />
We will similarly use the oxygen-sensitive NirB promoter to regulate transcription of the fluorescent [[Team:FHS_Frederick_MD/LOV_Domain|LOV protein]] that we are designing.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/Microbial_Fuel_CellsTeam:FHS Frederick MD/Microbial Fuel Cells2014-06-21T01:27:52Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Microbial Fuel Cells=<br />
[[File:FuelCell.jpg|right|500px]] A microbial fuel cell is a device that converts the chemical reactions of bacteria into electricity. Within the fuel cell certain bacteria under anaerobic conditions will remove the electrons from organic matter and transfer them to an anode, which will then transfer the electrons through a circuit to a cathode. The current and voltage produced by this process is what creates the electricity required to power certain objects such as a light bulb. <br />
<br />
The bacteria that we are currently creating is meant to optimize the microbial fuel cell's potential, as bacteria that will glow under anaerobic conditions will reveal any weaknesses in the fuel cell, structural or otherwise, which can then be assessed and dealt with.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/MembersTeam:FHS Frederick MD/Members2014-06-21T01:27:09Z<p>Rozakd: </p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
=Members=<br />
{| cellpadding="20"<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:KyleA.jpg|100px]]<br />
|style="vertical-align:top;"|'''Kyle Andrushko''' is an Eagle scout on the road to becoming an optometrist. Having recently graduated from Frederick High school, Kyle is planning on attending UMBC for his undergraduate degree with a major in biology and a minor in business. John's Hopkins medical school will be his next step after taking the OAT. Kyle will be participating in the iGEMs competition in Boston this summer. He has just finished up his first year of iGEMs and has gained expertise in the concepts of the NirB promoter gene. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DillonK.jpg|100px]]<br />
|style="vertical-align:top;"|'''Dillon Kestner''' is a Frederick High School graduate who has been inspired by the iGEMs club as well as his mentors Mark Trice and Dave Rozak to pursue a career in neuroscience. He plans to attend a local community college in order to continue being involved in his high school's iGEMs club and mentor future participants before transferring to Muhlenberg College to acquire a doctorate in neuroscience. Dillon specialized in the 3A assembly process for his group. Dillon looks ahead to the trip to Boston and seeing his group's work pay off as well as all the work put in by groups from all over the world.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:JonathonS.jpg|100px]]<br />
|style="vertical-align:top;"|'''Jonathon Soward''' is an 18 year-old who loves the study of life. Jonathon attributes his love of STEM to a string of inspiring STEM teachers at his school, including Mark Trice, Shelley Miller, and Joyce Tuten. His teachers, as well as his diligence and work ethic, has enabled him to decide upon pursuing a degree in both dentistry and microbiology. Jonathon has been a member of the iGEM team at Frederick High School for the past two years. He has also become resident expert in the light, oxygen, and voltage sensor protein(LOV). Jonathon's nickname is "master pipettor" because of his amazing pipetting skills!<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:AlanN.jpg|100px]]<br />
|style="vertical-align:top;"|'''Alan Nguyen''' is a recent graduate of Frederick High School and incoming Freshman to Mount St. Mary's University. Alan has taken an interest in biology and its many forms. This interest has given him the drive to pursue a career in medicine, a choice that he wouldn't have made without his AP Biology teacher, Mr. Trice's inspiration. A two year veteran of the iGEM group, Alan is excited to see the fruits of his group's labor as it unfolds at the iGEMS competition held at MIT. He's specialized himself in microbial fuel cells and now has a fuller understanding of his group's experiments. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:MarkT.jpg|100px]]<br />
|style="vertical-align:top;"|'''Mark Trice''' is a teacher at Frederick High School, where he teachers classes such as Chemistry, Physics, Biology, and Advanced Placement Biology. He also serves as the vice president on the board for the nonprofit organization, Ars Biotechnica. Mark has worked with his iGEM club for two years and is so excited to see this project come to fruition.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DaveR.jpg|100px]]<br />
|style="vertical-align:top;"|'''David Rozak''' is a research scientist at the United States Army Medical Research Institute for Infectious Diseases and a founding director of the nonprofit organization, Ars Biotechnica, Inc. Dave has been working with the Frederick High School Bioengineering Club for two years and served as an advisor to our iGEM team.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:GaryL.jpg|100px]]<br />
|style="vertical-align:top;"|'''Gary Lopez'''is an original founding member of the Frederick High Bioengineering Club. He graduated from Fredrick High School (with more accolades than are imaginable) and has transitioned to becoming a Hood College student. He has also taken the huge leap from curios member to knowledgeable mentor. His future goals include working in the biotechnology field, achieving a double major in biochemistry and computer science, and eventually owning your own biotechnology company.<br />
|}<br />
<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/MembersTeam:FHS Frederick MD/Members2014-06-21T01:26:27Z<p>Rozakd: </p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Members=<br />
{| cellpadding="20"<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:KyleA.jpg|100px]]<br />
|style="vertical-align:top;"|'''Kyle Andrushko''' is an Eagle scout on the road to becoming an optometrist. Having recently graduated from Frederick High school, Kyle is planning on attending UMBC for his undergraduate degree with a major in biology and a minor in business. John's Hopkins medical school will be his next step after taking the OAT. Kyle will be participating in the iGEMs competition in Boston this summer. He has just finished up his first year of iGEMs and has gained expertise in the concepts of the NirB promoter gene. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DillonK.jpg|100px]]<br />
|style="vertical-align:top;"|'''Dillon Kestner''' is a Frederick High School graduate who has been inspired by the iGEMs club as well as his mentors Mark Trice and Dave Rozak to pursue a career in neuroscience. He plans to attend a local community college in order to continue being involved in his high school's iGEMs club and mentor future participants before transferring to Muhlenberg College to acquire a doctorate in neuroscience. Dillon specialized in the 3A assembly process for his group. Dillon looks ahead to the trip to Boston and seeing his group's work pay off as well as all the work put in by groups from all over the world.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:JonathonS.jpg|100px]]<br />
|style="vertical-align:top;"|'''Jonathon Soward''' is an 18 year-old who loves the study of life. Jonathon attributes his love of STEM to a string of inspiring STEM teachers at his school, including Mark Trice, Shelley Miller, and Joyce Tuten. His teachers, as well as his diligence and work ethic, has enabled him to decide upon pursuing a degree in both dentistry and microbiology. Jonathon has been a member of the iGEM team at Frederick High School for the past two years. He has also become resident expert in the light, oxygen, and voltage sensor protein(LOV). Jonathon's nickname is "master pipettor" because of his amazing pipetting skills!<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:AlanN.jpg|100px]]<br />
|style="vertical-align:top;"|'''Alan Nguyen''' is a recent graduate of Frederick High School and incoming Freshman to Mount St. Mary's University. Alan has taken an interest in biology and its many forms. This interest has given him the drive to pursue a career in medicine, a choice that he wouldn't have made without his AP Biology teacher, Mr. Trice's inspiration. A two year veteran of the iGEM group, Alan is excited to see the fruits of his group's labor as it unfolds at the iGEMS competition held at MIT. He's specialized himself in microbial fuel cells and now has a fuller understanding of his group's experiments. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:MarkT.jpg|100px]]<br />
|style="vertical-align:top;"|'''Mark Trice''' is a teacher at Frederick High School, where he teachers classes such as Chemistry, Physics, Biology, and Advanced Placement Biology. He also serves as the vice president on the board for the nonprofit organization, Ars Biotechnica. Mark has worked with his iGEM club for two years and is so excited to see this project come to fruition.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DaveR.jpg|100px]]<br />
|style="vertical-align:top;"|'''David Rozak''' is a research scientist at the United States Army Medical Research Institute for Infectious Diseases and a founding director of the nonprofit organization, Ars Biotechnica, Inc. Dave has been working with the Frederick High School Bioengineering Club for two years and served as an advisor to our iGEM team.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:GaryL.jpg|100px]]<br />
|style="vertical-align:top;"|'''Gary Lopez'''is an original founding member of the Frederick High Bioengineering Club. He graduated from Fredrick High School (with more accolades than are imaginable) and has transitioned to becoming a Hood College student. He has also taken the huge leap from curios member to knowledgeable mentor. His future goals include working in the biotechnology field, achieving a double major in biochemistry and computer science, and eventually owning your own biotechnology company.<br />
|}<br />
<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/MembersTeam:FHS Frederick MD/Members2014-06-21T01:25:34Z<p>Rozakd: /* Members */ Added footer.</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
=Members=<br />
{| cellpadding="20"<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:KyleA.jpg|100px]]<br />
|style="vertical-align:top;"|'''Kyle Andrushko''' is an Eagle scout on the road to becoming an optometrist. Having recently graduated from Frederick High school, Kyle is planning on attending UMBC for his undergraduate degree with a major in biology and a minor in business. John's Hopkins medical school will be his next step after taking the OAT. Kyle will be participating in the iGEMs competition in Boston this summer. He has just finished up his first year of iGEMs and has gained expertise in the concepts of the NirB promoter gene. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DillonK.jpg|100px]]<br />
|style="vertical-align:top;"|'''Dillon Kestner''' is a Frederick High School graduate who has been inspired by the iGEMs club as well as his mentors Mark Trice and Dave Rozak to pursue a career in neuroscience. He plans to attend a local community college in order to continue being involved in his high school's iGEMs club and mentor future participants before transferring to Muhlenberg College to acquire a doctorate in neuroscience. Dillon specialized in the 3A assembly process for his group. Dillon looks ahead to the trip to Boston and seeing his group's work pay off as well as all the work put in by groups from all over the world.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:JonathonS.jpg|100px]]<br />
|style="vertical-align:top;"|'''Jonathon Soward''' is an 18 year-old who loves the study of life. Jonathon attributes his love of STEM to a string of inspiring STEM teachers at his school, including Mark Trice, Shelley Miller, and Joyce Tuten. His teachers, as well as his diligence and work ethic, has enabled him to decide upon pursuing a degree in both dentistry and microbiology. Jonathon has been a member of the iGEM team at Frederick High School for the past two years. He has also become resident expert in the light, oxygen, and voltage sensor protein(LOV). Jonathon's nickname is "master pipettor" because of his amazing pipetting skills!<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:AlanN.jpg|100px]]<br />
|style="vertical-align:top;"|'''Alan Nguyen''' is a recent graduate of Frederick High School and incoming Freshman to Mount St. Mary's University. Alan has taken an interest in biology and its many forms. This interest has given him the drive to pursue a career in medicine, a choice that he wouldn't have made without his AP Biology teacher, Mr. Trice's inspiration. A two year veteran of the iGEM group, Alan is excited to see the fruits of his group's labor as it unfolds at the iGEMS competition held at MIT. He's specialized himself in microbial fuel cells and now has a fuller understanding of his group's experiments. <br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:MarkT.jpg|100px]]<br />
|style="vertical-align:top;"|'''Mark Trice''' is a teacher at Frederick High School, where he teachers classes such as Chemistry, Physics, Biology, and Advanced Placement Biology. He also serves as the vice president on the board for the nonprofit organization, Ars Biotechnica. Mark has worked with his iGEM club for two years and is so excited to see this project come to fruition.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[Image:DaveR.jpg|100px]]<br />
|style="vertical-align:top;"|'''David Rozak''' is a research scientist at the United States Army Medical Research Institute for Infectious Diseases and a founding director of the nonprofit organization, Ars Biotechnica, Inc. Dave has been working with the Frederick High School Bioengineering Club for two years and served as an advisor to our iGEM team.<br />
|-<br />
|style="vertical-align:top; padding-top: 1.5em;"|[[File:GaryL.jpg|100px]]<br />
|style="vertical-align:top;"|'''Gary Lopez'''is an original founding member of the Frederick High Bioengineering Club. He graduated from Fredrick High School (with more accolades than are imaginable) and has transitioned to becoming a Hood College student. He has also taken the huge leap from curios member to knowledgeable mentor. His future goals include working in the biotechnology field, achieving a double major in biochemistry and computer science, and eventually owning your own biotechnology company.<br />
<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/FooterTeam:FHS Frederick MD/Footer2014-06-21T01:24:28Z<p>Rozakd: </p>
<hr />
<div>[[File:iGEM-logo.png|right|100px|link=Main_Page]]<br />
<br />
<br />
[[Main_Page|Return to the iGEM 2014 HS Main Page]]</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MDTeam:FHS Frederick MD2014-06-21T01:19:34Z<p>Rozakd: Added footer</p>
<hr />
<div>{{:Team:FHS_Frederick_MD/Header}}<br />
<br />
<!-- *** What falls between these lines is the Alert Box! You can remove it from your pages once you have read and understood the alert ***<br />
<br />
<html><br />
<div id="box" style="width: 700px; margin-left: 137px; padding: 5px; border: 3px solid #fe2b33; /*background-color: #fe2b33;*/"><br />
<div id="template" style="text-align: center; font-weight: bold; font-size: large; /*color: #f6f6f6*/; padding: 5px;"><br />
This is a template page. READ THESE INSTRUCTIONS.<br />
</div><br />
<div id="instructions" style="text-align: center; font-weight: normal; font-size: small; /*color: #f6f6f6*/; padding: 5px;"><br />
You are provided with this team page template with which to start the iGEM season. You may choose to personalize it to fit your team but keep the same "look." Or you may choose to take your team wiki to a different level and design your own wiki. You can find some examples <a href="https://2009.igem.org/Help:Template/Examples">HERE</a>.<br />
</div><br />
<div id="warning" style="/*text-align: center;*/ font-weight: bold; font-size: small; /*color: #f6f6f6*/; padding: 5px;"><br />
You <strong>MUST</strong> have the following information on your wiki:<br />
<ul style="font-weight:normal;"><br />
<li>a team description</li> <br />
<li>project description</li><br />
<li>safety information (did your team take a safety training course? were you supervised in the lab?)</li><br />
<li>team attribution (who did what part of your project?)</li><br />
</ul><br />
You may also wish to add other page such as:<br />
<ul style="font-weight:normal;"><br />
<li>lab notebook</li><br />
<li>sponsor information</li><br />
<li>other information</li><br />
</ul> <br />
REMEMBER, keep all of your pages within your teams namespace. <br><span style="font-weight:normal; font-style:italic;">Example: 2013hs.igem.org/Team:FHS_Frederick_MD/Our_Pets</span><br />
</div><br />
</div><br />
</html><br />
<br />
*********************** End of the alert box *********************** --><br />
<br />
<br />
=Overview=<br />
[[File:Tshirts.jpg|right|500px]]<br />
We are interested in creating a [[Team:FHS_Frederick_MD/Microbial_Fuel_Cells|microbial fuel cell]] that utilizes the facultative anaerobic bacteria, ''Shewanella oneidensis'', to produce [[Team:FHS_Frederick_MD/Renewable_Energy|renewable energy]] and [[Team:FHS_Frederick_MD/Clean_Water|clean water]]. <br />
<br />
In order to optimize the growth conditions in the anaerobic chamber of the fuel cell, a fluorescent protein marker will be added so to visualize bacterial growth under different conditions. <br />
<br />
We plan to accomplish this using the [[Team:FHS_Frederick_MD/NirB_Promoter|NirB oxygen-sensitive promoter]] to induce expression of the glowing gene only when oxygen is scarce. Furthermore, we must engineer a fluorescent [[Team:FHS_Frederick_MD/LOV_Domain|LOV domain]], which is optimized for expression in ''S. oneidensis'' and capable of fluorescence under anaerobic conditions. <br />
<br />
This genetic construct will help us ensure that the bacteria are actually growing under anaerobic conditions. This would lead to the creation of a BioBrick that can be deposited back into the “toolbox” parts repository for future iGEM teams.<br />
{{:Team:FHS_Frederick_MD/Footer}}</div>Rozakdhttp://2014hs.igem.org/Team:FHS_Frederick_MD/FooterTeam:FHS Frederick MD/Footer2014-06-21T01:18:19Z<p>Rozakd: Enlarged logo and linked to main page.</p>
<hr />
<div>[[File:iGEM-logo.png|right|100px|link=Main_Page]]</div>Rozakd